SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000899 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000899
Domain Number 1 Region: 506-822
Classification Level Classification E-value
Superfamily Ribonuclease H-like 8.34e-92
Family PIWI domain 0.015
Further Details:      
 
Domain Number 2 Region: 40-392
Classification Level Classification E-value
Superfamily PAZ domain 1.83e-69
Family PAZ domain 0.0000003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000899   Gene: ENSMODG00000000748   Transcript: ENSMODT00000000917
Sequence length 862
Comment pep:known_by_projection chromosome:BROADO5:3:423313621:423452955:-1 gene:ENSMODG00000000748 transcript:ENSMODT00000000917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYSGAGPALTAPPTPPSPMQATYTFKPPPRPDFGTSGRTIKLQANFFEMDIPKIDIYHYE
LDIKPEKCPRRVNREIVEHMVQHFKTQIFGDRKPVFDGRKNLYTAMPLPIGRDKQVELEV
TLPGEGKDRIFKVAIKWMSCVSLQALHDALSGRLPSVPFETIQALDVVMRHLPSMRYTPV
GRSFFTASEGCSNPLGGGREVWFGFHQSVRPSLWKMMLNIDVSATAFYKAQPVIEFVCEV
LDFKSIEEQQKPLTDSQRVKFTKEIKGLKVEITHCGQMKRKYRVCNVTRRPASHQTFPLQ
QESGQTVECTVAQYFKDRHKLVLRYPHLPCLQVGQEQKHTYLPLEVCNIVAGQRCIKKLT
DNQTSTMIRATARSAPDRQEEISKLMRSASFNTDPYVREFGIMVKDEMTDVTGRVLQPPS
ILYGGRNKAIATPVQGVWDMRNKQFHTGIEIKVWAIACFAPQRQCTEVHLKSFTEQLRKI
SRDAGMPIQGQPCFCKYAQGADSVEPMFRHLKNTYAGLQLVVVILPGKTPVYAEVKRVGD
TVLGMATQCVQMKNVQRTTPQTLSNLCLKINVKLGGVNNILLPQGRPPVFQQPVIFLGAD
VTHPPAGDGKKPSIAAVVGSMDAHPNRYCATVRVQQHRQEIIQDLAAMVRELLIQFYKST
RFKPTRIIFYRDGVSEGQFQQVLHHELLAIREACIKLEKDYQPGITFIVVQKRHHTRLFC
TDKNERVGKSGNIPAGTTVDTKITHPSEFDFYLCSHAGIQGTSRPSHYHVLWDDNRFSSD
ELQILTYQLCHTYVRCTRSVSIPAPAYYAHLVAFRARYHLVDKEHDSAEGSHTSGQSNGR
DHQALAKAVQVHQDTLRTMYFA
Download sequence
Identical sequences F6VPM9 G3W6U2
ENSSHAP00000011147 ENSMODP00000000899 XP_007488450.1.35504 ENSMODP00000000899 ENSSHAP00000011147

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]