SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001062 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001062
Domain Number 1 Region: 106-219
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.55e-19
Family Canonical RBD 0.0000508
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001062   Gene: ENSMODG00000000892   Transcript: ENSMODT00000001082
Sequence length 375
Comment pep:novel chromosome:BROADO5:2:484029842:484031103:-1 gene:ENSMODG00000000892 transcript:ENSMODT00000001082 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQYIRVSEDENDEPIEIPSDNNGTVLLSTVTAQFPGACGLCYRNPVSQSRRGEFLVEGI
LDARDAGWGNLVYVINYPKDNKRKMDEPDASSAVKLKRAVQKTSDLIVLDLSWKTIEQGV
KEYFITFGEVFMVQVKKDIKTGHSKGFGFVSFMEYKMQVKVMSQHHMIYGQWYDYKLPNS
KQSPNEPLRSRKFVGHCTEDMTADELQQCFCQYGEVVVFIPKQFRAFALHNSNRQLERNG
TFGDIPAFGKQGGFGNSRGGGAGLGKNQGSNMGGEMNFGAFSINLSMMATAQAALHSSWG
TRSILASQQNQSGPSGNKQSQGNMQRAPNQAFGPGNNSYSGSNSGAATGWSSASNARGSG
FNGGFDSSMDSKSSG
Download sequence
Identical sequences F7A7L2
13616.ENSMODP00000001062 ENSMODP00000001062 ENSMODP00000001062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]