SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001146 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001146
Domain Number 1 Region: 29-141
Classification Level Classification E-value
Superfamily SH2 domain 2.49e-31
Family SH2 domain 0.0000253
Further Details:      
 
Domain Number 2 Region: 155-216
Classification Level Classification E-value
Superfamily SH3-domain 7.22e-23
Family SH3-domain 0.00041
Further Details:      
 
Domain Number 3 Region: 4-41
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000235
Family SH3-domain 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001146   Gene: ENSMODG00000000961   Transcript: ENSMODT00000001170
Sequence length 217
Comment pep:novel chromosome:BROADO5:6:26010070:26085092:-1 gene:ENSMODG00000000961 transcript:ENSMODT00000001170 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MESVALYSFQATENDELPFNKGDTLKILNMEDDQNWYKAELRGAEGFIPKNYIQVKPHPW
FAGRISRQFAEEILLRRNHLGAFLIRESESSPGEFSVSVNYGNQVQHFKVLRENMGKYFL
WEEKFNSLNELVDFYRTTTIAKKKQIFLRDEEPVHKPPRTKFAKAQFDFTAQNPSQLSFY
QGDIIEVLEHSDPHWWRGQLCGRVGFFPRNYVQPVHM
Download sequence
Identical sequences F7F7G6
ENSMODP00000001146 ENSMODP00000001146 13616.ENSMODP00000001146 XP_001362980.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]