SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001216 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001216
Domain Number 1 Region: 2-102
Classification Level Classification E-value
Superfamily SH2 domain 4.71e-29
Family SH2 domain 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001216   Gene: ENSMODG00000001024   Transcript: ENSMODT00000001241
Sequence length 105
Comment pep:known_by_projection chromosome:BROADO5:2:53344492:53378920:-1 gene:ENSMODG00000001024 transcript:ENSMODT00000001241 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDLPFYHGPLSKRACERLLLQEGKDGKFLLRDSESLPGVLCLCVLFHKKIYTYRIRREKY
GYYTIETAEGVRRELFPNLNELISKYQKPNQGLVIRLCYPVEKNN
Download sequence
Identical sequences F6ZFC4
ENSMODP00000001216 ENSMODP00000001216 13616.ENSMODP00000001216

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]