SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001219 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001219
Domain Number 1 Region: 2-177
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.14e-18
Family Canonical RBD 0.00012
Further Details:      
 
Domain Number 2 Region: 215-292
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.06e-18
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Domain Number 3 Region: 531-612
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 9.94e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0017
Further Details:      
 
Domain Number 4 Region: 319-395
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 1.61e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0015
Further Details:      
 
Domain Number 5 Region: 449-526
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 8.77e-16
Family Eukaryotic type KH-domain (KH-domain type I) 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001219   Gene: ENSMODG00000001014   Transcript: ENSMODT00000001244
Sequence length 660
Comment pep:known_by_projection chromosome:BROADO5:8:300286120:300391539:1 gene:ENSMODG00000001014 transcript:ENSMODT00000001244 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNKLYIGNLSDSVSPVDLESIFNDSKIPYTGSFLVKTGYAFVDCPDENWAMKAIETLSGK
VEVHGKLIEVEHSVPKRQRSRKIQIRNIPPHLQWELTVDLYCGPLSLGTQVVFIPCWKVL
DSVLAQYGSVENCEQVNTDTETAVVNVTYSCKEQARLAIEKLNGFQLEGYTLKVAYIPDE
LADLPMPHSPVMSNRRGYGHRGSQRQGSPGGASGQNHQNDVPLRMLVPTQFVGAIIGKEG
ATIRNITKQTQSKIDIHRKENAGASEKPITIHASPEGCSTACKIIMEIMQKEAQDTKLRF
HGISSRTGLNALPRTYTDEIPLKILAHNNFVGRLIGKEGRNLKKIEQDTDTKITISPLQE
LTLYNPERTITVKGSIETCGKAEEEIMKKIRESYESDLSAMNLQAHLLPGLNLNALGLFP
ASTSGIPSPSTLGVPSAAAATNYLPYGQQAETETVHLFIPAMAVGAIIGKMGQHIKQLSR
FAGASIKIAPPETPDAKERMVIITGPPEAQFKAQGRIYGKLKEENFFGPKEEVKLEAQIK
VPSYAAGRVIGKGGKTVNELQNLTSAEVVVPRDQIPDENDEVIVKITGHFYACQLAQRKI
QEILAQVKRQQQMQQQKNANAAAAAAAAAAAASAAAATGGGGGASAAVPGTSGQLQPRRK
Download sequence
Identical sequences F6ZFA4
ENSMODP00000001219 ENSMODP00000001219 XP_007505431.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]