SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001242 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001242
Domain Number 1 Region: 16-321
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.78e-54
Family Protein kinases, catalytic subunit 0.0022
Further Details:      
 
Domain Number 2 Region: 317-383
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000774
Family Canonical RBD 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001242   Gene: ENSMODG00000001048   Transcript: ENSMODT00000001268
Sequence length 393
Comment pep:novel chromosome:BROADO5:2:53400432:53418404:1 gene:ENSMODG00000001048 transcript:ENSMODT00000001268 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGSGCLWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGTPGSPPGALKQFLPPG
TTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIQFSPNMPSRCLLLELLDVSVSE
LLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGL
SFKEGNQDVKYIQTDGYRAPEAEIQNCLAQAGLQSETECTSAVDLWSLGIILLEMFSGMK
LKHTIRSQEWKVNSSAIIDHIFASKAVVTSAIPAYHLRDLIKSMLHDDPGRRIPADMALC
SPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEECQKYGPVVSL
LVPKENPGRGQVFVEYANAEIAVEGAEWTGFGL
Download sequence
Identical sequences F6YRV2
ENSMODP00000001242 ENSMODP00000001242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]