SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001250 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001250
Domain Number 1 Region: 491-717
Classification Level Classification E-value
Superfamily SET domain 2.88e-56
Family Histone lysine methyltransferases 0.0023
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001250
Domain Number - Region: 413-451
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00435
Family Myb/SANT domain 0.032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001250   Gene: ENSMODG00000001054   Transcript: ENSMODT00000001276
Sequence length 727
Comment pep:novel chromosome:BROADO5:3:414345762:414348009:1 gene:ENSMODG00000001054 transcript:ENSMODT00000001276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IMGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFNSNRQKILERTEILNQE
WKQRRIQPVHIMTSVSSLCGIRECSVTSDLDFPKQVIPLKTLNAVASVPIMYSWSPLQQN
FMVEDETVLHNIPHMGDEVLDRDGTFIEELIKNYDGKVHGDRECGFINDEIFVQLVNALD
EKQKDLEDNRDDDKESHPPRKFPSDKIFEAISSMFPDKGTSEELKEKYKELTEQQLPGAL
PPECTPNIPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPFHATLNTYKRKNTETALDNK
PCGPHCYQHLEGAKEFAAALTAERIKTLPKCPGGRQRGRLPNNSSRPSTPTINVLESKDT
DSDREAEAETGGENNDKEEEEKKDETSSSSEANSRCLTPIKMKPNIEPPENVEWNGAEAS
MFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPAEDVDTPPRKKRKHQLW
AAHCRKIQLKKDGSSNHVYNYQPCDHPHQPCDSSCPCVIAQNFCEKFYQRSSECQNRFPG
CRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNMSGKNCSIQRGSKKHLQLAPS
DVAGWGIFIKDPVQKNEFISEYCGEIISQDETDRRGKVYDKYMCSFLFNLNNNFVVDATS
KGNKIRFANHSVNPNCYAKVVMVNGDHRIGIFAKIAIQTGEELFFDYRYSQADALKYIGI
EREMEIP
Download sequence
Identical sequences F6YRI3
13616.ENSMODP00000001250 ENSMODP00000001250 ENSMODP00000001250

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]