SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001321 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001321
Domain Number 1 Region: 406-613
Classification Level Classification E-value
Superfamily PUA domain-like 5.47e-79
Family SRA domain-like 0.0000000034
Further Details:      
 
Domain Number 2 Region: 1-85
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.34e-17
Family Ubiquitin-related 0.0000369
Further Details:      
 
Domain Number 3 Region: 708-766
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000000783
Family RING finger domain, C3HC4 0.011
Further Details:      
 
Domain Number 4 Region: 322-376
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.00000000000215
Family PHD domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001321   Gene: ENSMODG00000001108   Transcript: ENSMODT00000001349
Sequence length 787
Comment pep:known_by_projection chromosome:BROADO5:3:441797627:441844841:1 gene:ENSMODG00000001108 transcript:ENSMODT00000001349 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWIQVRTMDGKETHRVDSLSKLTKVEELRLKIQEVFRVEPGRQRLFYRGKQMEDGHSLFD
YNVGLNDIVQLLVRQSPAVLSVPSKEKDSELSDTDSGCCSGQSESDKSSNHGEGALEIDG
QPGPAAQGDWIDPGFGLYKINEYVDARDMNMGAWFEGILVNVTRKEREASESSDNEDGQV
AEEDVIYHVKYEDYPENGVVKLSSKDVRARARTILKWHQLEVGQIVMVNYNPDEPKERGF
WYDAEILRKRETRTVKEIYANLLLGDAGDSLNDCRITFVDEVYKIEEPGSASPVGFENLL
KRQSGPICKHCKDNPNKTCKMCACHVCGGKQDPDKQLMCDECDMAFHIYCLSPPLSRIPD
DEDWYCPECRNDASEVVLAGEKLKESKKKAKMASATSSSQRDWGKGMACVGRTRECTIVP
SNHYGPIPGIPVGTMWKFRVQVSESGVHRPHVAGIHGRSNDGAYSLVLAGGYEDDVDHGN
SFTYTGSGGRDLSGNKRTAEQSCDQKLTNMNRALALNCSAPINDRGGAEAKDWRAGKPVR
VVRNVKGGKHSKYAPAEGNRYDGIYKVVKYWPEKGKSGFLVWRYLLRRDDDEPGPWTREG
KDRMKKLGLTMQYPEGYLEAVAKKEKEKENNKSDDEELTSPRKGKGKRKRKSSGGRETFL
DSPSTDSKKTKVEPYKLTSQQKTLIKNDESNEKLWNEVLSALKDGPKFLNKVEETFLCIC
CQEVVFRPITTMCQHNVCKDCLDRSFRAEVYSCPACRYELGKSYSMQVNQTLQTILSQLF
PGYGNGR
Download sequence
Identical sequences F7DPG2
ENSMODP00000001321 XP_016287583.1.35504 XP_016287584.1.35504 ENSMODP00000001321

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]