SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001326 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001326
Domain Number 1 Region: 53-119
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000011
Family Growth factor receptor domain 0.0055
Further Details:      
 
Domain Number 2 Region: 119-190
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000068
Family Fibronectin type I module 0.094
Further Details:      
 
Domain Number 3 Region: 217-262
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000034
Family TSP-1 type 1 repeat 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001326   Gene: ENSMODG00000001114   Transcript: ENSMODT00000001354
Sequence length 370
Comment pep:known_by_projection chromosome:BROADO5:3:412111898:412156766:1 gene:ENSMODG00000001114 transcript:ENSMODT00000001354 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRWLLPWFIAAAAVVTAAAGSNLSKALIQNSTVMPPTSVPAEDTSSRPQFCKWPCECPPT
APRCPPGISLITDGCECCKVCAQQLGDNCTEAATCDPHRGLYCDYSGDGPRYAIGVCAPP
KMVGVGCVLDGVRYRNGQSSQPNCKFNCTCINGAVGCIPLCTNSRAPRLWCPNPKKIKMA
GRCCEQWICDDSRKPRKTLPRHISPAASEGDTESWQKNCIVHTSSWSPCSRSCGMGISTR
ISNNNAQCQLSKERRLCNLRPCEVDITQHIKPGKKCLAVYQAELPMNLTISGCVSTNSYR
PKYCGICTDNRCCTPYKSKTIVVNFQCPDGPGFSWKLMWINACFCNLSCRNPNDIFADLE
QYHDYAEIAN
Download sequence
Identical sequences F7DPD9
13616.ENSMODP00000001326 ENSMODP00000001326 ENSMODP00000001326

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]