SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001337 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001337
Domain Number 1 Region: 81-184
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 8.6e-26
Family Canonical RBD 0.00000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001337   Gene: ENSMODG00000001122   Transcript: ENSMODT00000001365
Sequence length 381
Comment pep:known_by_projection chromosome:BROADO5:8:90379684:90450881:-1 gene:ENSMODG00000001122 transcript:ENSMODT00000001365 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GNQEPTATPDAMVQPFTTIPFPPPPQNGIPTEYGVPHTQDYAGQTSEHNLTLYGGTQTHG
EQSTNTASTQNGALTTEGGAQTDGQQSQTQSSENTESKSTPKRLHVSNIPFRFRDPDLRQ
MFGQFGKILDVEIIFNERGSKGFGFVTFENSADADRAREKLHGTVVEGRKIEVNNATARV
MTNKKMVTPYANGWKLSPVVGAVYGPELYAAASSFQADVSLGNDAAVPLSGRGGINTYIP
LISKILSSLSLLFSAVPGFPYPTAATTAAAFRGAHLRGRGRTVYGAVRAVPPTAIPAYPG
VVYQDGFYGADLYGGYAAYRYAQPATATAATAAAAAAAAYSDGYGRVYTADPYHALAPAA
SYGVGAVASLYRGGYSRFAPY
Download sequence
Identical sequences F7DP45
ENSMODP00000001337 13616.ENSMODP00000001337 ENSMODP00000001337

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]