SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001370 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001370
Domain Number 1 Region: 349-518
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.25e-21
Family Canonical RBD 0.0085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001370   Gene: ENSMODG00000001149   Transcript: ENSMODT00000001398
Sequence length 607
Comment pep:known_by_projection chromosome:BROADO5:5:214498917:214576876:-1 gene:ENSMODG00000001149 transcript:ENSMODT00000001398 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPPPNPETDSSFYPGMSSINPAFFQSFSPVSPHNPCAGMSVPGGGGGGGGGGFGSPFSAA
AVPPPPPAMNLPQQPPSAPQPQPAPPAPQPPPPPSSRRSPVSPQLQQHQAAAAAAFLQQR
NSYNHHQPLLKQSPWSNHQSSGWSTGSMSWGAMHGRDHRRTGNMGIPGTMNQISPLKKPF
SGNVIAPPKFTRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVRSSLQLPAWGSDSLQDSW
CTAAGTSRIDQDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNAR
SYGRRRGRSSLFPIDDGLLDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPD
IDEDEITASFRRFGPLVVDWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKL
YLCVSSPTIKDKPVQIRPWNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDR
LYGGVCYAGIDTDPELKYPKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVL
DDQMCDECQGARCGGKFAPFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPR
QIHFRWN
Download sequence
Identical sequences F7D423
ENSMODP00000001370 ENSMODP00000001370

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]