SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001390 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001390
Domain Number 1 Region: 58-175
Classification Level Classification E-value
Superfamily SH2 domain 3.5e-31
Family SH2 domain 0.0000685
Further Details:      
 
Domain Number 2 Region: 10-78
Classification Level Classification E-value
Superfamily SH3-domain 0.00000143
Family SH3-domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001390   Gene: ENSMODG00000001164   Transcript: ENSMODT00000001418
Sequence length 278
Comment pep:known_by_projection chromosome:BROADO5:3:411851286:411946828:-1 gene:ENSMODG00000001164 transcript:ENSMODT00000001418 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGNSMKTSTAAPERPLPGPTGLDNDFLAVLCDYPSPDISPPIFRRGEKLRVISDEGGWWR
AISLSTGRESYIPGMCVAKVYHGWLFEGLGRDKAEELLLLPDTKMGSFMIRESETKKGFY
SLSVRHRQVKHYRIFRLPNNWYYISPRLTFQCLEDLVNHYSEVADGLCCVLTTPCLTQCT
TGNAERASGSPVVMRQKNFNWKNVARVQSGPDGETNHLEMDESLFSYGLRESIASYLSLA
GEDGSSFANDRKKKSHSLIYTGNKRKSALFSAPQYFED
Download sequence
Identical sequences F7CJV5
ENSMODP00000001390 XP_007488419.1.35504 XP_007488420.1.35504 XP_007488421.1.35504 XP_007488422.1.35504 ENSMODP00000001390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]