SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001412 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001412
Domain Number 1 Region: 402-489
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.17e-23
Family Canonical RBD 0.0026
Further Details:      
 
Domain Number 2 Region: 29-67
Classification Level Classification E-value
Superfamily SAP domain 0.0000000181
Family SAP domain 0.0035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001412   Gene: ENSMODG00000001178   Transcript: ENSMODT00000001440
Sequence length 951
Comment pep:novel chromosome:BROADO5:3:443004712:443045821:-1 gene:ENSMODG00000001178 transcript:ENSMODT00000001440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEALSGAGDSGSGSAGLGSASSETGTRRLSDLRVIDLRAELKKRNLDTGGNKSILMDRL
KKAIEEEGGDPDEIEIASEASSKKITKRHIKGRKPEEEGAEDNGLEEDSGDGQEDNETSL
DNLQDIDMMDISVLDETEIDNGSAADCGEDYSADNILDSLSDSKENADAELKQLPDQLTE
HTTTGEGVGNSLDASSSDFTVIQDNEEPPLEPENEKILDILGETCKSDPLKEEGSDLEQP
FSQDASSVGPNKKLAEEEDNFDTAHPEEDALDVDSESTQAIAKKAEKHLDIVKREKSEQK
VDEEKMDSDTVVVENLNDQSSKASENAEASSEEAQETPEKASSPETKDSKEDIKKSEDEA
YNEDSSATKESSTNEGGDQKMSFIEDDTDIKPALKDDKGRVSSSSGRNLWVSGLSSTTRA
TDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTSDEATKCINHLHRTELHGRMISV
EKAKNEPAGKKPSDRKDCEIKKEKSSSGERHHSTDSRSERSSALSTASPSSSRTVIKSEK
KEDKRSEDRKDEKDQDELKPGSADRSRATKSGSRGTERTVVMDKSKGEPVISVKTTTRSK
DRSSKSQDRKSESKEKRDILSFDKIKEQRERERQRQREREIRETERRREREQREREQRID
AFRERKEKARLQRERVRLECQRQRLERERMERERLERERIRVEQERRKEQERIHREREEL
RRQQEQLRYEQERRPALRRPYDVDSRRDDSYWPEGKRAALDDRYRSEFSRQDRFHDFDHR
ERSRYQDHSVDRREGSRSVMGERDGQHYADDRHGGPERHGRDSRDGWGGYGSDKRMSEGR
GLPPPPPRGGREWGDHTQRIEDHQDRSWQGSVDGGMMGRDHERWQGGERGMSGHSGPGHM
VNRGGMSGRGGFAQGGNSQGHVMQGGAMQGRGFGGQDRASRGSHPHFTRRY
Download sequence
Identical sequences F7GHE1
ENSMODP00000001412 ENSMODP00000001412

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]