SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001422 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000001422
Domain Number - Region: 6-26
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0518
Family CCCH zinc finger 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001422   Gene: ENSMODG00000001184   Transcript: ENSMODT00000001450
Sequence length 733
Comment pep:known_by_projection chromosome:BROADO5:2:108313083:108363353:1 gene:ENSMODG00000001184 transcript:ENSMODT00000001450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSNQGEDCYFFFYSTCTKGDSCPFRHCEAALGNETVCTLWQEGRCFRQVCRFRHMEIDKK
RSEIPCYWENQPMGCQKLNCAFHHNRGRYVEGLFLPPSKTILPLVPESPDEEVKSSQLSM
QQNKLSVQSNPSPQLRGVMKVESSENVPSPTHPPVVINAADDDEDDDDQFSEEGDETKTP
ILQPAPEVHNGLRITGARKPGVSLKQGDSLNFGIKTLEEIKSKKMKEKSKKQGEGPSGAC
AHLLQPQPIPGPEKENVRTVVRTVTLSNKQGEEPLVRLSLTERLGKRKLSGVDSDPPLKR
SLAQRLGKKIESPEMNTDKTPKKVQVSKSLKERLGMPADLNSMETTERSAKGGEIHVKTL
EEIRLERASQKRGELLTKIKNEGPHKPEDSNLGMRSSSAIRIKTFSEVLAEKKHRQQEEE
RQKAEKENPSVKLRIESESKKPAILPPSTTSKGQLEEPAMKTKPMQEVHIKTLEEIKQEK
ALRVQQSAENSTSSQTQPETTPIIRRLLRITKRTGVKEEKKLSEAGETTSRIGVSRTEAV
EVSSQTSDETTGDSISKVQVKKFEDIMREKRMQKQQEVEMLPKDKVLTPLQEEAAPSNTQ
VVEKSELNTVSGITRQLTKRMPIKAQQVELETSGIGDSILNVKCAAQPLEKRGKAKPKVN
VKPSVVKVISTPKLATKRKAAEVHPAVIAAVKPLSSGNILQESPSKKAAVAAVPVLSEDK
PVTVSETEKTPNR
Download sequence
Identical sequences F7GHC1
ENSMODP00000001422 ENSMODP00000001422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]