SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001484 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001484
Domain Number 1 Region: 408-494
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.17e-20
Family Canonical RBD 0.0046
Further Details:      
 
Domain Number 2 Region: 29-67
Classification Level Classification E-value
Superfamily SAP domain 0.0000000311
Family SAP domain 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001484   Gene: ENSMODG00000001236   Transcript: ENSMODT00000001516
Sequence length 933
Comment pep:novel chromosome:BROADO5:3:443046366:443082565:1 gene:ENSMODG00000001236 transcript:ENSMODT00000001516 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEILSGAGDSSSVTAGLSSASSETGTRRLSDLRVIDLRAELKKRNLDSGGNKSVLMDRL
KKAIEDEGGNPDEIEITSEGSKKTTPKRSSNKAGRKAEEEGAEDNGLEENSGDEQEDVET
SLDNFRDIDMMDISVLDEAEIDNGSAVDCGEDYSADNILDSLSDSKENADAEMKEFPDQL
TEHAMADKESVNNLDTSSSDFTVVQEIEDPSLEPENEKILDILGETCKSDPLKEEGSDLE
QPFSQDASSVGPNKKLAEEEDNFDTAHPEEDALDVDSESTQAIAKKAEKHLDIVKREKSE
QKVDEEKMDSDTVVVENLNDQSSKASENAEASSEEAQETPEKASSPETKDSKEDIKKSED
EAYNEDSSATKESSTNEGGDQKMSSVEEDSDTKRVSKDEKGHTTSSCGRNFWVSGLSSTT
RAIDLKNLFSKYGKVVGAKVVTNARSPGARCYGFVTMSTSEEATKCINHLHKTELHGKMI
SVEKTKNEPAGKKTSDKRESDGKREKSTNSDRYLYSLWVGGCDIIPRSTNIKRDDKTDKK
DDTRKEDGSDEKDKDEQKPGSDRARATKSGSRGTERTVVMDKSKGEPVISVKTSGGKEGI
SKSQDRKSASREKRSVVSFDKSRDQRKIRDSESRRACEWSEREERIQALQEREERERLEI
ARERLAVQRQRLERERMERERLERERMHIEYERRREQERIHREREELRRQQALRYEQGRR
PAIRRPYDVDGRRDDSYWPEGKRAALDDRYHSEFSRQDRFHDFDHRDRGRYQDHSVDRRE
SSRSMMGDRDGQHYAERRGGPDRRGRESRDEWSSYASEKRMSKGRGLPPPPRGRDWGDHS
RRLDDHQDRSWQGNVDGGMMGRDHERWQGGERSMSGHSGPGHVMNRGGMSGRGSFAGGNS
RGHVMQGGGMQGGEFGEQDRGNRPNDTRFTRRY
Download sequence
Identical sequences F7FX32
ENSMODP00000001484 13616.ENSMODP00000001484 ENSMODP00000001484

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]