SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001487 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001487
Domain Number 1 Region: 153-320
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.29e-28
Family Canonical RBD 0.0042
Further Details:      
 
Domain Number 2 Region: 77-151
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 3.09e-16
Family Canonical RBD 0.0000628
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001487   Gene: ENSMODG00000001242   Transcript: ENSMODT00000001519
Sequence length 669
Comment pep:known_by_projection chromosome:BROADO5:2:26526276:26611193:-1 gene:ENSMODG00000001242 transcript:ENSMODT00000001519 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAGPEREEEVVVAAAVEAAGEPEEPGLVPAAAPEPLPPGASTAAEELAQPPEPPEPLG
AAEVARRLQRTRRELSNRRKVLLRNLPPDTHSQEVHDLLKDYELKYCYVDRNKRTAFVTL
LDGEQAQNAIQTFHQYSLRGKEITVQLQPTDALLCITNLPPSFTIEEFEELVRTFGNIER
CFLVYNETTGHSKGYGFVEYMKKDSAAKARSELLGKQLGSFILFAQWMDVNQLATDLIHS
KCLCVDKLPRDLTDSQELLQIFSFSHKPVFGQLAQDEGSYADGFAVVEYDSPEHAEDVQQ
AADGMTIKGSQVQVSFCAPGASGRSTLAALIAAQRMMRNNRKGLLPEPNPIQIMKSLNNP
AMLQILLQPQLQGPAVLGAPHSLPHLVNPSITPAILQLNKIHQNLSYLHLAQQQLMKIEN
IQTNSKPGLLGEPPAMVLPTALGAGAAPPLKSELGLRGEEHKTAAGLLPFFPNQHVVGPS
HPQDKPSAALGSAEGAASGLQTYLPGFTNPPAGGSAPGQPRQASQPKASEASSGTVSKNQ
TSLLGEPPKEIRLSTNPYLNLASVLPGVCLPAPVGSKTMSALPQTGITSNILDAISQGTS
SQHALENYINYSQQFGDYSQVSSPLRNEKRGSTYLISAPEGSSGELVDQHSQGTGGYYAE
SCLKKKRVY
Download sequence
Identical sequences F7FX11
ENSMODP00000001487 ENSMODP00000001487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]