SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001502 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001502
Domain Number 1 Region: 61-109
Classification Level Classification E-value
Superfamily Cysteine-rich DNA binding domain, (DM domain) 1.57e-17
Family Cysteine-rich DNA binding domain, (DM domain) 0.0003
Further Details:      
 
Domain Number 2 Region: 310-355
Classification Level Classification E-value
Superfamily UBA-like 0.00000000408
Family TS-N domain 0.077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001502   Gene: ENSMODG00000001251   Transcript: ENSMODT00000001534
Sequence length 531
Comment pep:known_by_projection chromosome:BROADO5:2:4721291:4726457:1 gene:ENSMODG00000001251 transcript:ENSMODT00000001534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MELRSELPSVPSAAGPPVAPGSVASVASVAAAAAAAASLPVSVAGGLLRAPPLLLRAAEK
YPRTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEE
NEARELQLLYGTAEGLALAAANGIIPPRPAYEVFGTVCPDSASGAGPGPGPGSVPGGAGG
GPGGTEAKLQKFDLFPKGLLQPGGAASPQPPGGKPVSPDGADSAPGTSSPEARPGSGSEN
GDGDSFLGSPLSKALKEGGGGGGGSGSGSGGGGPGDDDSPGSISPLGSDSGSEADKDEAT
ASPPPSGSGPGPRQRTPLDILTRVFPSHKRSVLELVLQGCGGDVVQAIEQILNHHRGAAV
AGGAAVAAVAAGGLDKGPDESWTGRADGSGGALGAALQPGPATAHHPHHRPLLAGAMTPA
IGTLGSRSAFSPLQPNASHFGAEAGAYPLGTPLGLSPLRLAYSAAAHSRGLAFMAPYSTA
GLMPTLGFRPPMDYAFSDLMRDRSASVHKEPVYSNGGGLYGPLVNNTPDKQ
Download sequence
Identical sequences F7CJ78
ENSMODP00000001502 XP_001362692.1.35504 ENSMODP00000001502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]