SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001532 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001532
Domain Number 1 Region: 3-214,311-564
Classification Level Classification E-value
Superfamily Ras GEF 1.57e-104
Family Ras GEF 0.00012
Further Details:      
 
Domain Number 2 Region: 273-320
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000548
Family Ras-binding domain, RBD 0.00053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001532   Gene: ENSMODG00000001277   Transcript: ENSMODT00000001564
Sequence length 565
Comment pep:known_by_projection chromosome:BROADO5:8:301288444:301369787:1 gene:ENSMODG00000001277 transcript:ENSMODT00000001564 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LPTFDVPYFKYIDEEDEEDEWSNRSQSSTEDESSDSLLSDRYVVVSGTPEKILEHLLNDL
HLEEVQDKETETLLDDFLLTYTVFMTTDDLCQALPPQHWPHGPAHLFSLTLRTYSAKKYH
GREETCDIPRRKRKVLHLVSQWIGLYKDWLHEDEHSKMFLKTIYRNVLDDVYEYPVLEKE
LKELQKMLGLHRRHTVDEYSPHRKNKALFHQFSLKENWLQHRGTVGETEEIVVCHVSLVN
DSDPNMYVSVRDAAMSTGFLPVSRLCSHSVSFDFLKEKHELQPNDLAISKSLELSGRIYV
YRKDLSETLSPLVESEESQQRSLRILGMNTWDLAMELMNFDWSLFNSIHEQELIYFTFSR
PGSSENTVNLSLLLQRCNEVQLWVATEILLCSQLCKRVQLVKKFIKIAAHCKAQRNLNSF
FAIVMGLNTASVSRLSQTWEKIPGKFKKLFSELESLTDPSLNHKAYRDAFKKMKPPKIPF
MPLLLKDVTFIHEGNKTFLDNLVNFEKLHMIADTVRSLRHCRNSHFGGDVSPKEHQELRS
YVHHLHVIDNQQVLFELSHRIEPRA
Download sequence
Identical sequences F7CIQ4
ENSMODP00000001532 ENSMODP00000001532 13616.ENSMODP00000001532

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]