SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001566 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001566
Domain Number 1 Region: 20-127
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.28e-29
Family Canonical RBD 0.0000142
Further Details:      
 
Domain Number 2 Region: 130-218
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.91e-23
Family Canonical RBD 0.0000177
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001566   Gene: ENSMODG00000001300   Transcript: ENSMODT00000001598
Sequence length 287
Comment pep:known_by_projection chromosome:BROADO5:2:4920510:5065141:-1 gene:ENSMODG00000001300 transcript:ENSMODT00000001598 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVMIISTMEPQVSNGPASNTTNGPSSNGRNCPSPMQTGATTDDSKTNLIVNYLPQNMTQE
EFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAINTLNGLRLQTKTIKVS
YARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILVDQVTGVSRGVGFIRF
DKRIEAEEAIKGLNGQKPSGATEPITVKFANNPSQKTSQALLSQLYQSPNRRYPGPLHHQ
AQRFRLDNLLNMAYGVKRFSPITIDGMTSLVGMNIPGHTGTGWGGLV
Download sequence
Identical sequences F7BZX1
ENSMODP00000001566 ENSMODP00000001566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]