SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001568 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001568
Domain Number 1 Region: 57-224
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.29e-31
Family Canonical RBD 0.0049
Further Details:      
 
Domain Number 2 Region: 230-324
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 2.69e-20
Family Canonical RBD 0.0001
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001568
Domain Number - Region: 391-467
Classification Level Classification E-value
Superfamily dsRNA-binding domain-like 0.0112
Family Double-stranded RNA-binding domain (dsRBD) 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001568   Gene: ENSMODG00000001302   Transcript: ENSMODT00000001600
Sequence length 583
Comment pep:known_by_projection chromosome:BROADO5:5:121914918:121996120:-1 gene:ENSMODG00000001302 transcript:ENSMODT00000001600 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNEENLDVTNGCSKVRTGTQNEAALLALMEKTGYNMVQENGQRKFGGPPPGWEGPPPPRG
CEVFVGKIPRDMYEDELVPVFERAGKIYEFRLMMEFSGENRGYAFVMYTTKEEAQLAIRI
LNNYEIRPGKFIGVCVSLDNCRLFIGAIPKEKKKEEILDEMKKVTEGVVDVIVYPSATDK
TKNRGFAFVEYESHRAAAMARRKLIPGTFQLWGHTIQVDWADPEKEVDEETMQRVKVLYV
RNLMISTTEETIKAEFNKFKPGAVERVKKLRDYAFVHFFNREDAVAAMSVMNGKCIDGAS
IEVTLAKPVNKESTWRQHLNGQISPNSENLLVFANKEEGHQKTLGKPPSLPARLNGQHSP
SPPEIERCTYPFFPGTKLTPISMYSLKSNHFNSAVMHLDYYCNKNNWAPPEYYLYSTTSQ
DGKVLLVYKIVIPAIANGSQSYFMPDKLCTTLEDAKELAAQFTLLHLDKQLLSAFEEIKI
LTTFVKVMRSIANSRMTGNTISSAWTCVGEFGENKLRDYNFRRSSVNSISPVSATLSSGT
PSVLPYTSRPYSYPSYPLSPTISLANGSHVGQRLYISNQASFF
Download sequence
Identical sequences F7BZW1
ENSMODP00000001568 ENSMODP00000001568

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]