SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001586 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001586
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.81e-18
Family La domain 0.0034
Further Details:      
 
Domain Number 2 Region: 124-187
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000478
Family Canonical RBD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001586   Gene: ENSMODG00000001314   Transcript: ENSMODT00000001619
Sequence length 200
Comment pep:novel chromosome:BROADO5:3:443363713:443365216:1 gene:ENSMODG00000001314 transcript:ENSMODT00000001619 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PDPQLVRNIIAQVESYLSNENLAQDAFLLKHVQKSKLGFLSGDHMSSLPQVKCLTRDWRL
TCYALRSSAMLEVNEEGTKVRRRIPVPDWLLVLSHTKLLLVWEDPEPGFPRESTVQPPGF
LAAVSNLFGPFGALTSIRVLRPGKKLPPDVLPYATRYPELLHCPCALVQFESVEAAGQAF
TTLQEDPRGFRVVRLAKKGH
Download sequence
Identical sequences F7BEH8
13616.ENSMODP00000001586 ENSMODP00000001586 ENSMODP00000001586

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]