SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001615 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001615
Domain Number 1 Region: 322-395
Classification Level Classification E-value
Superfamily F-box domain 4.32e-16
Family F-box domain 0.0038
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001615
Domain Number - Region: 2-79
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00103
Family Ubiquitin-related 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001615   Gene: ENSMODG00000001336   Transcript: ENSMODT00000001649
Sequence length 518
Comment pep:known_by_projection chromosome:BROADO5:8:87278758:87299993:1 gene:ENSMODG00000001336 transcript:ENSMODT00000001649 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLRVRVRKRTAPLELPGAEPTLGELRAHLRQALLPAWGYSSDIQFAVTLNSKDALTEDE
KTLAEYGIVCGDLICLVLEEATEDLPRASLDLAHSSFASNHDQPSLATSQSLRSRQGERE
LNDPYSAVQSAESMPGSSLDLDSGLIQEDVDMEEGTGGYPSEPMLCSEAVDGQVPHSLEM
LYHSAECSSTNDALIVLVHLLMLESGYIPLGTEAKAVSMPENWRSGGVYKLQYMHPLCED
GTAALTCVPLGSLIVINATLKINNEIRSVKRLQLLPESFICPPKQAEEQVASKYKDLQKL
SRLFKDQLVYPLLAFARQALNLPDVFGLVVLPLELKLRIFRLLDVRSVLALSAVCRDLFN
ASNDQLLWRFMYLRDFRDGAVRPRDTDWKELYRKQKQRKDALRWRHAMFLPPPPHPMPFH
PSPFYPSPFPPNPMYPPGIIGGEFDERPVLPYVGDPINSLIPGPGEAPGQFSPFRPHFDP
MGPFPGPNPVLPGRGGPSDRFPFRPSRGRPTDIRLSFI
Download sequence
Identical sequences F7FWC2
ENSMODP00000001615 XP_001366168.1.35504 ENSMODP00000001615

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]