SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001617 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001617
Domain Number 1 Region: 347-659
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.46e-74
Family FMN-linked oxidoreductases 0.0000325
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001617
Domain Number - Region: 169-208
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.0017
Family CCCH zinc finger 0.0059
Further Details:      
 
Domain Number - Region: 130-156
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.00366
Family CCCH zinc finger 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001617   Gene: ENSMODG00000001339   Transcript: ENSMODT00000001651
Sequence length 723
Comment pep:novel chromosome:BROADO5:3:443368866:443397339:-1 gene:ENSMODG00000001339 transcript:ENSMODT00000001651 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEETLGLKGQSGVGGTVDTGTSERGVAPIKPQYLTTKEQFHTFLGTRGKRVEQAVGEPN
SERAERESPICCNSSEPGAKRLKLADGQVESLESQSSGVGVGEPHQKKKARGQNKSRPHM
KPTHYDDNRLCPSLVQESADKCFFGERCRFLHDVDTYLASKPPDLGDKCVLFETFGKCIY
GVTCRFARAHLGPQHQNLVKEELVKQWEGQKLTSNGLSKDLQHRLRKKKVQFDHSEKYLK
QLSKSGRVGTGKDQIPILPAGPEAPKGEQSKAYIDFPGHMAQNSASGDANESLASLESGL
PLSETVSGILEKGTTPQRNIVCSSGHLTDEDLIKLRPCEKKRLNIQNKLYLAPLTTCGNL
PFRRICKRFGADVTCGEMAVCTNLLQGQSSEWALLKRHHTEDLFGVQLEGAFPDTMTKCA
ELLNQTVEVDFVDINVGCPIDLVYKKGGGCALMNRSNKFEQIVRGMNQVLDVPLTVKIRT
GVQEKVNLAHRLLPELREWGVALATLHGRSREQRYTKGADWQYIQHCAEVAHPMPLFGNG
DILSYEDANRALQTGVSGIMIARGALIKPWLFTEIKEQRHWDISSGERLDILRDFTNYGL
EHWGSDTQGVEKTRKFLLEWLSFLCRYIPVGLLEHLPQKINERPPYYLGRDHLETLMASQ
NVDDWISISEMLLGPVPPAFTFLPKHKANSYRIIQPVPSPKSGERSVPVSAGRFPDGALR
LFL
Download sequence
Identical sequences F7FWB8
ENSMODP00000001617 ENSMODP00000001617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]