SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001664 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001664
Domain Number 1 Region: 110-211
Classification Level Classification E-value
Superfamily SH2 domain 1.88e-30
Family SH2 domain 0.0000451
Further Details:      
 
Domain Number 2 Region: 45-111
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000217
Family SH3-domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001664   Gene: ENSMODG00000001378   Transcript: ENSMODT00000001698
Sequence length 289
Comment pep:known_by_projection chromosome:BROADO5:1:390039935:390074742:-1 gene:ENSMODG00000001378 transcript:ENSMODT00000001698 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MACFRAICQGTMGSLPSRKRRGLHVPGLPAHSQETGLLQEGLFTVPVSPDRSKDMAVALD
SFPAGEQGELVLRLGEPLIIISDNGEWWRVLSEATSKEYVVPSSHVARISQGWLYEGLNR
EKAEDLLLLPSNHGGSFLIRESQTRRGAYSLSVRLSRPTSRDVVRHYRIHRLENGWFYIS
PRLTFPSLQALVEHYTEMADDLCSLLVEPCAFRRVGLLPGRNIPPPVSVQRPTLNWKEVD
SSLLFSEVSSSGDTCPISVGLREAIGTYISMTEDPSLDISGHRRVKKGN
Download sequence
Identical sequences F7FJB7
ENSMODP00000001664 XP_001381553.3.35504 ENSMODP00000001664

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]