SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001679 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001679
Domain Number 1 Region: 479-746
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 3.64e-83
Family Protein kinases, catalytic subunit 0.000000389
Further Details:      
 
Domain Number 2 Region: 2-211
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 5.75e-46
Family FCH domain 0.003
Further Details:      
 
Domain Number 3 Region: 382-512
Classification Level Classification E-value
Superfamily SH2 domain 8.48e-31
Family SH2 domain 0.00052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001679   Gene: ENSMODG00000001390   Transcript: ENSMODT00000001714
Sequence length 753
Comment pep:known_by_projection chromosome:BROADO5:3:44334819:44519602:-1 gene:ENSMODG00000001390 transcript:ENSMODT00000001714 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TWLLMIQQTEQLSRIMKTHAEDLNSGPLHRLTMMIKDKQQVKKSYIGVHQQIETDMFKVT
KTELDKLKASYRQLIKEMNYAKEKYKEALSKGKETEKAKDRYDKATMKLHMLHNQYVLAL
KGAQLHQHQYYDTTLPQLLDSLQKMQEEMINALKSIFDEYSQITSLVTEEIVNVHKEIET
SVEQIDPSTEYNNFIDVYRSPGIEEQEIEFDASLLEENENLKANEIMWNNLTAESLQIML
KTVEEDLIQTQQMLLNKEEVVLELEKSIEESSKTCEKKSDIVLLLSQKQALEELKQSIQQ
LRCTEAKFAAQKELLEQKVQENDGKEPPPVFNYEEDARSVTSMEKKEKLSKFDSIRHSIA
GMIRSPKSVLGSPSLTDVISSSEKPLVEQDWYHGAIPRIEAQELLKHQGDFLVRESHGKP
GEYVLSVFSDGQRRHFIIQFADNLYRFEGTGFPAIPQLIEHHYTTKQVITKKSGVVLLNP
VVKDKKWILSHEDVTLGELIGKGNFGEVYKGTLKDKTPVAVKTCKEDLPQELKIKFLQEA
KILKQYDHPNIVKLIGVCTQRQPIYIIMELISGGDFLSYLRKKKDELKLKQLVKFALDAA
SGMAYLESKNCIHRDLAARNCLVGENNVLKISDFGMSRQEDGGVYSSSGLKQIPIKWTAP
EALNYGRYSSESDAWSFGILLWETFSLGVCPYPGMTNQHAREQVEQGYRMAAPQRCPEEI
YKIMLKCWDYKPENRPSFIELQKELAAIKKKVS
Download sequence
Identical sequences F7FIZ2
ENSMODP00000001679 ENSMODP00000001679 13616.ENSMODP00000001679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]