SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001787 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001787
Domain Number 1 Region: 582-778
Classification Level Classification E-value
Superfamily PUA domain-like 2.98e-40
Family LON domain-like 0.0068
Further Details:      
 
Domain Number 2 Region: 229-328
Classification Level Classification E-value
Superfamily TPR-like 3.8e-18
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 
Domain Number 3 Region: 490-537
Classification Level Classification E-value
Superfamily RING/U-box 1.83e-16
Family RING finger domain, C3HC4 0.0088
Further Details:      
 
Domain Number 4 Region: 141-207
Classification Level Classification E-value
Superfamily RING/U-box 0.000000000732
Family RING finger domain, C3HC4 0.028
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001787
Domain Number - Region: 29-101
Classification Level Classification E-value
Superfamily TPR-like 0.000253
Family Tetratricopeptide repeat (TPR) 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001787   Gene: ENSMODG00000001472   Transcript: ENSMODT00000001825
Sequence length 787
Comment pep:known_by_projection chromosome:BROADO5:7:62105394:62223432:-1 gene:ENSMODG00000001472 transcript:ENSMODT00000001825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGTKPGQTERVSPPPGPDAGAPCPELLSVAEEAFRGGNYELAAEIYGSQLAELPQPERSL
CLRRGDALARAGRAAEALDSYTVAARLGNLRPEELKELVESCALAIREELRLPPWEPAPC
GGESSAWDEPAATPDPVSAATSSSSTLADAWDLFCCPRCRLLLCDPVTLHCGHTLCKRCT
ETDPGLPAGPCCPAAKSPPSREDSCPARVNVVLGNLLEKCFQTESRVRRLVSQAESLQHR
HELDAALHKYDQALELAPGDSLLTVQRAELCTVMKKYNQALHDADAICRRKPLWPKGHYV
KAQALLGLGKTEEALKEFLYCVALNPGRGIMKKEAQKIMCEVFFPALENVHENLSSPIRS
RTPYTRLKPKFLSNINTKSKLEDDSSAGCSKDSLFQFNKILSQESDVYQNSDSSVSHHVL
DLHFEDKKTFKTALSNVSSASLKRKFSADLEDVLNLNIPNKISKEDEETLPQIVPSTKLG
KSPVILLDASDFECSLCMRLFYEPVTTPCGHTFCLKCLERCLDHTPDCPLCKEKLSEFLA
SRSYKKTILTEELILRYLPEELSDRKKVYDDEMKELSNLTKDVPIFVCTMAFPTIPCPLH
VFEPRYRLMIRRCMETGTKRFGMCLADELKGFADYGCMLEIRDVRFFPDGSSVVDTVGIS
RFRVLSHGLRDGYNTANIEYLEDKKVEGPDYEELVHLHDSVYDQAVSWFTSLKENMKAQI
LNHFGSMPSKVSEPQSNPSGPAWYWWLLAVLPLENRAQLAILGMTSLKDRLIAIRRVLIF
VTRKRPR
Download sequence
Identical sequences F7AP56
ENSMODP00000001787 ENSMODP00000001787 XP_007501189.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]