SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001813 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001813
Domain Number 1 Region: 285-427
Classification Level Classification E-value
Superfamily PH domain-like 1.72e-39
Family Third domain of FERM 0.00000942
Further Details:      
 
Domain Number 2 Region: 181-286
Classification Level Classification E-value
Superfamily Second domain of FERM 2.62e-36
Family Second domain of FERM 0.00000428
Further Details:      
 
Domain Number 3 Region: 101-180
Classification Level Classification E-value
Superfamily Ubiquitin-like 8.47e-27
Family First domain of FERM 0.0000842
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001813   Gene: ENSMODG00000001490   Transcript: ENSMODT00000001852
Sequence length 1585
Comment pep:novel chromosome:BROADO5:1:389524676:389604496:1 gene:ENSMODG00000001490 transcript:ENSMODT00000001852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTMETGPDAEVKKAQEDPPPPPPQQLEASASQAPVAAAPAGPAEANSSEKQGSQADPRPA
EQGLDMEEKDYVETDGLSDRTTPSKTQKSPQKIAKKFKSAICRVTLLDASEYECEVEKHG
RGQVLFDMVCEHLNLLEKDYFGLTFCDPDSQKNWLDPSKEIKKQIRSGPWNFAFTVKFYP
PDPAQLTEDITRYYLCLQLRADIITGRLPCSFVTHALLGSYAVQAELGDFDAEEHVGNYV
SELRFAPNQTKELEERIMELHKTYRGMTPGEAEIHFLENAKKLSMYGVDLHHAKDSEGID
IMLGVCANGLLIYRDRLRINRFAWPKILKISYKRSNFYIKIRPGEYEQFESTIGFKLPNH
RSAKRLWKVCIEHHTFFRLVSPEPPPKGFLVMGSKFRYSGRTQAQTRQASALIDRPAPFF
ERSSSKRYTMSRSLDGAEFSRPASVSENHDVGPEAEKHEEDGDYGGGRRKSETEEGELRT
PTKIKELKPEQETTPRHKQEFLDKPEDVLLKHQASINELKRTLKEPNSKLIHRDRDWERE
RRLPSSPASSSPKREEGTPKGTPEKANESQRTEDTSQLEPRIALGLESFTQKSLASSPEG
SEHWVFIERECSQPEELTFRNLSTTQPEEPPTTAPSDDLSSKGVSKVDVRVDKFRVEVAT
EELVRMKGQGETCQRGRMIASPEDFESVWEDGVGGEVTVEEYRVSASQLKGKSELRKELE
EFQACRQLSATGAVAPQEVPGMKPGDLCSESPASEKEGMKASLGDSTRADSSDETETSPA
ERSFYLSFADKEQEELASFVTEDRKVANLGPIKEDGKGQLELEDESTVAPELNSLDQAVP
IVGSNTGMSSEGDEPPTIDVGLDELKVLLEQLSKKTPLSHRPSSNEKSSFERKEEFLDPT
SDKYIEEEMPETGNSIEKAQESPLDGFNKHSPSKGEGNEFPNRDPDPGAAILPKRVPQGG
VNKSNRQKEGHFLLQERRLFQALEGDLELNEKKASTVFLQMEGIIMKDSALASPENSEVL
AAWEVHADPLLQKQEQQSNDGPSDTELPIVFPKTFRFSKGGLGTKDTAVSEGANTEELPI
VNGKPKGGAKPTEPGDLVLTTLGREPKQGISFQASGHEGSQEDISKTSVANKIKIFERGD
THGEDNFWASIGDSRALPSEQSSEPFPGQVEQQRNKLLELGFVQPHPPNPIRAVLVATEL
YQKRDEELTQAPVDSGSEATLAEARSKTREPVREEKDLSGSAVKVAPKEESHSSGPQAAQ
RAGLREGSEEKVKPPHPRAPESDPGDEDQDQERDSVFLKDNHLAIERKCSSITVSSTSSL
EAEVDFTVIGDYHGTAFEDFSRSLPELDRDRSDSEAEGPIFPRDLDKAAPSQDDDSKAAS
EASERGVCPAPDMPHFEPVKTETMTVSSLAIRKKIEPEAALQSRISAVDTTQQVDGGTPG
GKETTTTSHSVTTETTCTTLENSLKSGKGATAMIPGPQTVATEIRSLSPIIGKDVLAGAY
GATAETLSTSTTTHVTKTVKGGFSETRIEKRIIITGDEDVDQDQALALAIKEAKLQHPDM
LVTKAVVYRETDPSPEERDKKPQES
Download sequence
Identical sequences F7F4R0
ENSMODP00000001813 ENSMODP00000001813

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]