SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001831 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001831
Domain Number 1 Region: 98-163
Classification Level Classification E-value
Superfamily Retrovirus capsid dimerization domain-like 2.2e-26
Family SCAN domain 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001831   Gene: ENSMODG00000001504   Transcript: ENSMODT00000001871
Sequence length 175
Comment pep:known_by_projection chromosome:BROADO5:1:389297857:389298381:-1 gene:ENSMODG00000001504 transcript:ENSMODT00000001871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAEPESAGPLSPAPPENEAASPVKLEEPAASRDSSKAPASLPGPVAPEASPRVPAASPPA
SPPAPGPAAQATSPPSPVPFPAVLEASPLAPSPAGSRPGPETFRQRFRQFRYHEAAGPRE
AFHQLRELSRQWLRPEVRTKEQIVEMLVQEQLMAILPEELRARRRGRRSDVRITG
Download sequence
Identical sequences F7F4G7
ENSMODP00000001831 ENSMODP00000001831 13616.ENSMODP00000001831

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]