SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001901 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001901
Domain Number 1 Region: 250-338,433-508
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.36e-34
Family Canonical RBD 0.0016
Further Details:      
 
Domain Number 2 Region: 74-107,147-227
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.19e-19
Family Canonical RBD 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001901   Gene: ENSMODG00000001557   Transcript: ENSMODT00000001942
Sequence length 533
Comment pep:known_by_projection chromosome:BROADO5:1:389112256:389138321:-1 gene:ENSMODG00000001557 transcript:ENSMODT00000001942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADDIDIEAMLEAPYKKDENKLSSANGHEERSKKRKKSKSRSRSHDRKRSKSKERKRSRD
RERKKSKSRERKRSRSKERRRSRSRSRERRFRGRYRSPYSGPKFNSAIRGKIGLPHSIKL
SRRRSRSKSPFRKDKSPVREPIDNLTPEERDARTVFCMQLAARIRPRDLEEFFSTVGKVR
DVRMISDRNSRRSKGIAYVEFVDVSSVPLAIGLTGQRVLGVPIIVQASQAEKNRAAAMAN
NLQKGSAGPMRLYVGSLHFNITEDMLRGIFEPFGRIESIQLMMDSETGRSKGYGFITFSD
SECAKKALEQLNGFELAGRPMKVGHVTERTDASSASSFLDSDELERTGIDLGTTGRLQLM
ARLAEGTGLQIPPAAQQALQMSGSLAFGAVAAKIFFPFFIDLQTRLSQQSEVTALAAAAS
VQPLATQCFQLSNMFNPQTEDELGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVK
CPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPVRR
Download sequence
Identical sequences F7BX84
ENSMODP00000001901 13616.ENSMODP00000001901 ENSMODP00000001901

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]