SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001919 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001919
Domain Number 1 Region: 626-703
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000000421
Family Canonical RBD 0.019
Further Details:      
 
Domain Number 2 Region: 985-1054
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000121
Family Canonical RBD 0.022
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001919
Domain Number - Region: 386-412
Classification Level Classification E-value
Superfamily CCCH zinc finger 0.000118
Family CCCH zinc finger 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001919   Gene: ENSMODG00000001574   Transcript: ENSMODT00000001961
Sequence length 1104
Comment pep:known_by_projection chromosome:BROADO5:7:140282601:140386614:-1 gene:ENSMODG00000001574 transcript:ENSMODT00000001961 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKPSKIDLPSGADVPSWRSVSCDADPSALAKYVLALVKKDKSEKELKALCIDQLDVFLQK
ETQIFVEKLFDAVNTKSYLPPPEQPSSGSLKVEFFQHQEKDIKKDEENDLQTGKDRTNMV
KRDLEPKIGEEIVREHLATLNEFKSPGLDELHPRVLKELTDVIAEPLSVIFDESWRTGEV
PRDWRRANVPIFKKGKKVDSTNYRPITKEEEREKKFSRRLNHSPPQSSSRYRENRSRDDR
KKDDRSRKRDYDRNPPRRDSYRDRYNRRRGRSRSYSRSRSRSWSKERLRDRDRDRSRTRS
RSRTRSRERDLGKPKYDLDRTDPLENNYTPVSSVTNISSGHYPVPTLSSTITVIAPTHHG
NNTTESWSEFHEDQVDHNSYVRPPMPKKRCRDYDEKGFCMRGDMCPFDHGSDPVVVEDVN
LPGMLPFPAQPPVVEGPPPPGLPPPPPILTPPPVNLRPPVPPPGPLPPSLPPVTGPPPPL
PPLQPSGMDAPPNSATSSVPTVVTTGIHHQPPPAPPSLFTADTYDTDGYNPEAPSITNTS
RPMYRHRVHAQRPNLIGLTSGDMDLPPREKPPNKSSMRIVVDSESRKRTIGSGEPGVPAK
KTWFDKPNFNRTNSPGFQKKVQFGNENTKLELRKVPPELNNISKLNEHFSRFGTLVNLQV
AYHGDPEGALIQFATYEEAKKAISSTEAVFNNRFIKVYWHREGAAQQLQTASQKVIQPLV
QQPSLPVVKQSVKERLGPVPSSNIEPTEAQSAGPDIPQNVTKLSVKDRLGFVSKPSVSAT
EKVLSTSTGLTKTVYNPAALKAAQKSLPAVSISTLDNSEAQKKKQEALKLQQDVRKKKQE
ILEKHIETQKMLISKLEKNKAMKSEDKAEIMKTLEALTNSITKLKDELKAVSSGSSLPKS
VKTKAQMQKELLDTELDLYKKMQAGEEVTELRRKYTELQLEAAKRGILSTGRGRGIHSRG
RGTIRGRGRGRGRGRGVPGHAVVDHRPRALEISAFTESDREDLLPHFAQYGEIEDCQIDD
SSLHAVITFKTRAEAEAAAIHGSRFKGQDLKLAWNKPVINMSAVEAEEVEPDEEEFQEES
LVDDSLLQDDDEEEEDNESRSWRR
Download sequence
Identical sequences F7BX04
ENSMODP00000001919 ENSMODP00000001919

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]