SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001932 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001932
Domain Number 1 Region: 986-1336
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.14e-95
Family Phoshoinositide 3-kinase (PI3K), catalytic domain 0.000000429
Further Details:      
 
Domain Number 2 Region: 803-983
Classification Level Classification E-value
Superfamily ARM repeat 8.06e-56
Family Phoshoinositide 3-kinase (PI3K) helical domain 0.00024
Further Details:      
 
Domain Number 3 Region: 318-474
Classification Level Classification E-value
Superfamily Ubiquitin-like 3.05e-34
Family Ras-binding domain, RBD 0.0054
Further Details:      
 
Domain Number 4 Region: 639-786
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 1.11e-33
Family PLC-like (P variant) 0.0075
Further Details:      
 
Domain Number 5 Region: 1364-1489
Classification Level Classification E-value
Superfamily PX domain 2.22e-27
Family PX domain 0.0016
Further Details:      
 
Domain Number 6 Region: 1506-1631
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.83e-26
Family Synaptotagmin-like (S variant) 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001932   Gene: ENSMODG00000001583   Transcript: ENSMODT00000001974
Sequence length 1634
Comment pep:known_by_projection chromosome:BROADO5:2:109890654:109946843:-1 gene:ENSMODG00000001583 transcript:ENSMODT00000001974 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSTQGDGEHWKSLESVGISRKELAMAEALQMEYDALSRLRHDKEENRKVKQNTDSSLIS
WDGPVLDFYGKPAGGRNDLKLLRGLSGSDPTLNYNSFSPQDGAPNHSTSEGPQPGPDPWL
KGPLSGDYLYIFDGSDGGVSPPPGQEDRNSSPKKLSPPPIPPRVSIWDAPPQPPSKTYTL
SPKPSEPNDINTFSSNQQPPSKLLGRRILEEEEPGGRGQGNLLGSVDYDGINDAITRLNL
KSTYDTELLQDPKRGWKEGQGLLGFGKDTPGKPVARSKTMPPQVPPRTYAYRYANRKNVA
PSKNRRISVDPVSSRPRSTANGYELFEVSEERDEEVAAFCHMLDILRSGSDIQDYSLTGY
VWSAVNLSPEHLGAGVSLKVTVVCEGLREPLTFTCDCSSTVDLLIYQTLCYTHDELRGVD
VGDFVLKLCGLEEFLQNKHPLGSHEYIQQCRKFDTDIRLQLMKRKDVRTDLARTMNDDQS
PSTLNHYIHLQERPVKQTISRQALSLLFDTFHNEVDAFLLAEGDFPLKADRVVQSVKAIC
NALADVESPEITNALNQLPPCPSRMQPKIQKDPSVLAVRENREKVVEALTAAILDLVELY
CNTFNADFQTVVSGNQKHELVQEACLLSGPLAFTVYATHRIPITWATSYEDFYLSCSLSH
GGKELCSPLQTRKAHFYKYLFHLIIWDQQICFPVQINRLPRETLLSATLYAVPIPPPGSS
SEANKQRRVPEALGWVTTPLFNFRQVLTCGRKLLGLWPATQDNPSARWSAPNFHQPDSVI
LQIDFPTSAFDIKFTSPPGAEFSPQYEFRSLGGEDQQRLKDIMQKESLYWLTDADRKRVW
EKRYYCHSEVSSLPLVLASAPSWEWACLPDIYALLKQWTHMNHQDALGLLHATFPDQEVR
RMAVQWIDSISDAELLDYLPQLVQALKYECYLDSPLVRFLLKRAVCDLRVTHYFFWLLKD
GLKDSQFSIRYQYLLAALLCCCGKGLREEFNRQCWLVNTLAKLAQQVREATPSARQGILR
TGLEEVRKFFKINGSCRLPLSPSLLVKGIVPRDCSYFNSNAVPLKLSFQNVDPLGENIRV
IFKCGDDLRQDMLTLQMIRIMNKIWIQEGLDMRMVIFRCFSTGRGRGMVEMIPNAETLRK
IQVEHGVTGSFKDRPLADWLQKHNPGEDEYEKAVENFIYSCAGCCVATYVLGICDRHNDN
IMLKTTGHMFHIDFGRFLGHAQMFGNIKRDRAPFVFTSDMAYVINGGDKPSSRFHDFVDL
CCQAYNLIRKHTHLFLNLLGLMLSCGIPELSDLEDLKYVYDALRPQDTEANATTYFTRLI
ESSLGSVATKLNFFIHNLAQMKFTGSDDRLTLSFAPRTYTLKSSGRISDVFLCRHEKVFH
PHKGYIYVVKVMRENAHEAIYIQRTFEEFQELHNKLRLLFPSFHLPSFPSRFVIGRSRGE
AVAERRKELLNSYIWHLIHFSPEVAECDLVYTFFHPLPRDDKAAGISPAPKSSDGTWARP
VGKVGGEVKLSISYKNDKLFIMVMHIRGLQLLQDGNDPDPYVKIYLLPDPQKTTKRKTKV
ARKTCNPTYNEMLVYDGIPKGDLQQRDLQLSVLSEQGFWENILLGEVHIRLRELDLTQEK
MGWFELGSRSHGIV
Download sequence
Identical sequences F7BBM1
ENSMODP00000001932 ENSMODP00000001932 XP_007481285.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]