SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001944 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001944
Domain Number 1 Region: 568-652,822-898
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.24e-22
Family Canonical RBD 0.000017
Further Details:      
 
Domain Number 2 Region: 445-540
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 7.66e-22
Family Canonical RBD 0.00000306
Further Details:      
 
Domain Number 3 Region: 318-407
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.07e-16
Family Canonical RBD 0.0034
Further Details:      
 
Domain Number 4 Region: 25-109
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000000231
Family Canonical RBD 0.0065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001944   Gene: ENSMODG00000001591   Transcript: ENSMODT00000001986
Sequence length 901
Comment pep:known_by_projection chromosome:BROADO5:1:389063021:389068642:-1 gene:ENSMODG00000001591 transcript:ENSMODT00000001986 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLCYLLRKYICCFFRCVLFQRSMAVVIRLQGLPIVAGTMDIRHFFSGLTIPDGGVHIVGG
ELGEAFIVFATDEDARLGMMRTGGTIKGSKVTLLLSSKTEMQNMIELSRRRFETANLDMP
PANASRSGPPPSSGMSGRVNLPTTVPNFNNPSPSVVTAATSVHESNKNIPTFSTANIGTA
PPNIGASFGSPTFSSTLPSTASSMSTVPPPPIPPIPAMPSLPPMPSIPPIPVPPPVPTLP
PVPPVPPIPPVPPVPPMSPMPPLSGMPPLNPPPVAPIPTGMNGSGAALNLNSNLNPMFLG
PLNPVNPIQMNSQSSLKPLPINPDDLYVSVHGMPFSAMETDVKDFFHGLRVDAVHLLKDH
VGRNNGNGLVKFFSPQDTFEALKRNRMLMIQRYVEVSPATERQWVAAGGHITFKQSMGPS
GQTHPPPQTLVRSKSPSGQKRSRSRSPHEPGFCVYLKGLPFEAENKHVIDFFKKLDIVED
SIYIAYGPNGKATGEGFVEFRSESDYKAALCRHKQYMGNRFIQVHPITKKGMLEKIDMIR
KRLQNFSYDQREIILNTEGDSSPKLCAHISNIPFNITKMDILQFLEEIPVDENAVHILVD
NTGQGLGQALVQFKTEDDAHKAERLHRKKLNGREALLHVITLEDMREIEKNPPSQVKKGL
KIPLPGNATVPGMPNAGGDEHAFLTVGSKEANNGPPFNFPSNFSGSNAFGPPLPPPGLGG
AFGDARPGIPSVGNSGLPGLGIDVQGFGSGPNNLSGPSAFGAAPQNFGNGPGTLSGPPSF
GGGPPGLGSTAGHLSGPPSFGPGPGALHIGGPPGFGTTSGKPGPTVIKVQNMPFTVSVDE
ILDFFYGYQVIPGSVCLKYNEKGMPTGEAMVAFESRDEAMAAVVDLNDRPIGSRKVKLVL
G
Download sequence
Identical sequences F7BBB9
ENSMODP00000001944 13616.ENSMODP00000001944 ENSMODP00000001944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]