SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001969 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001969
Domain Number 1 Region: 294-402
Classification Level Classification E-value
Superfamily SH2 domain 9.69e-27
Family SH2 domain 0.00038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001969   Gene: ENSMODG00000001611   Transcript: ENSMODT00000002011
Sequence length 431
Comment pep:known_by_projection chromosome:BROADO5:1:60719128:60924693:1 gene:ENSMODG00000001611 transcript:ENSMODT00000002011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLQQILREMYIDPELLAELNDEQKHILFYKMREEQLRRWHEREARAAREEAEGGMLRNFR
RANSKHIQWLHGIDGEVWVWIMGEAPGDKPYEQISEELIAERARQQAQKEAEELWRQKEA
EITKKFRDAMANEKARILAEKWKVEMEDRKAAKILEERIHEEFKRKEEEERKKGEMQIRL
QEEQRAKELYWTLKQAQQQSQASEKEEREWEEQLRRSKAADEERRWKAQRARDEYRRHSL
RAIQKGTVAGLSNMFQEIGLYNEQEAKLNNHHSSPTPPKSLLVPVRTWERPLRPVSREII
IRWFKEEQLPRRAGFERNTKSIAPWFHGIISREEAEDLLSNMTEGAFLVRVSEKIWGYTL
SYRQQHGFKHFLVDASGDFYSFLGVDPNRHATLTDLIDFHKEEIITVSGGELLQKPCGQR
DNPPDYHMLFE
Download sequence
Identical sequences F7BAG9
13616.ENSMODP00000001969 ENSMODP00000001969 ENSMODP00000001969

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]