SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001997 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001997
Domain Number 1 Region: 182-281
Classification Level Classification E-value
Superfamily SH2 domain 1.48e-17
Family SH2 domain 0.001
Further Details:      
 
Domain Number 2 Region: 39-92
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.00000000000767
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0052
Further Details:      
 
Domain Number 3 Region: 123-178
Classification Level Classification E-value
Superfamily SH3-domain 0.000000172
Family SH3-domain 0.0035
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001997
Domain Number - Region: 1-49
Classification Level Classification E-value
Superfamily PH domain-like 0.017
Family Pleckstrin-homology domain (PH domain) 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001997   Gene: ENSMODG00000001634   Transcript: ENSMODT00000002039
Sequence length 322
Comment pep:novel chromosome:BROADO5:5:120727095:120728079:1 gene:ENSMODG00000001634 transcript:ENSMODT00000002039 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LIHLQGKQGFQIFCKTKDRKRKWMEQFERAMSNLKPEKANANHHNFQMNTFDKTTNCEAC
KMFLKGTFCQGYLCTKCGVGAHKDCLEAFPSCNIRSPEYLDTLSMRVLPKLGTVQSYHDI
PSPPGKSGLTCQGGDVFELLRGPPDSQWEEGRLMQTQESGSFPSSSVKPCPSPSSRVLSR
ETVYSRYPCFAGKMEREDTEKVLQSPKSGTYLIRERPKLSHFLNIKFKYEMKHIKVVKKA
NSFYVTESKMFESLLDLFEYYQCHSLKEDSEDLDTTLESPYKFPLRSCSKASTWSRGYNP
HVIGMTLAINNVAARDLSELPL
Download sequence
Identical sequences F7AMP0
13616.ENSMODP00000001997 ENSMODP00000001997 ENSMODP00000001997

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]