SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002001 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002001
Domain Number 1 Region: 1209-1430
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.15e-53
Family DBL homology domain (DH-domain) 0.00028
Further Details:      
 
Domain Number 2 Region: 1422-1553
Classification Level Classification E-value
Superfamily PH domain-like 9.25e-18
Family Pleckstrin-homology domain (PH domain) 0.021
Further Details:      
 
Domain Number 3 Region: 1563-1628
Classification Level Classification E-value
Superfamily SH3-domain 4.2e-17
Family SH3-domain 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002001   Gene: ENSMODG00000001635   Transcript: ENSMODT00000002043
Sequence length 1651
Comment pep:known_by_projection chromosome:BROADO5:8:207300019:207331694:1 gene:ENSMODG00000001635 transcript:ENSMODT00000002043 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRSLPLREGRGRLGGWGGWGLSRGLPAGAGTPVAFFLPRKPGPCDTDQESALMEAEEPPH
RASTPTTTLENLHVFPTSLMKNSCIPGLDPEAAETDNPAWEWTEDDDDVFGAQRRDLSSQ
KTTEETPPTLSQEDSPALEPDSGDVVTAESSVWRPSGLASQGLKEVHTPFLPTESSVLPT
LVESLGIGYIPDEISSNIGLKYWSEFLNSLMETERSEASNILEKGIFLPSSTQARSYSPP
EEPSSLLCHDASRTVQQEGKAQDQERKENGGHQRQEKATDTGKWWKQKQWEREQRELEWN
DALSGKQALDVVTCLHGPVGEQGQEDKGQFDLVVGKQKGETFNREVKDQNHREGYQGEKD
AEKQGHGKVEEQKNQENEFLEEQGKVDHYDTDQVLDEKQKIVNVGKENQGTIEKQSQLEE
EAKKEQGNVAEKTEAEEIMTSENDKVQKHYGPFPLISVVPDANVSWNSFPEDPVSTVTRS
ITQEGIKTESSRVELSMYSSCPDSASRPRQGASRSYQPIPPHNLSGKYSEKEADQNGWEE
ECGLGDGAMPNSGKKPTPPRPIAIVSRKDTSTSFSSTKKDPNTTTSSSSCPPTFPIGDSL
LPSYLSEFPRSFSFEKEFPFDHWDPDSPLNILPLPSSGETPLAPHGNSDWANALNVQDFS
EETIQYYGSNSAPSSYREGQSYYLAQNPASFQHSELAQRVPEPSIHSVDIPGREGQARLE
PSSDPSSLNQPQELNSNLQRPDATHSKSPPKKEALISGGLTIHDFPPSSSMVEMGLHERL
PPLPLRERHSHPPLVVRPSIHLAKPPTPKRYSHPPILARVSPMPGSPEGPSIPVKARHNR
PLPSTPVTDTSHHIQTPRLRYNKPLPPTPIMVQPYYPPTSTTLSKKNKPLPPVPILEPDP
KPPPLPPKAKWRNNSIQGTPGSTGDQLRSKPGGNPEVPSPLSAGHASWPPAVDRPTDSLT
SPGRNKRETSSLAFSNMTNFLLLSPSSSASSMTQEPQHPILGGVQDEHGQSEGTKSLPKK
TLSKGILQREGSGSRRSDRGLTWQSEKPSHPPLEKASSWPHRKDPGKFLEGSRGHSESPA
EGQNKTKGWNRQGLRRPSIFPGEVQDGEASPMDRPLCPSDTTVLQEKKSREGMGSVARRC
SKFINSSHLLYQEYSDVALNKEIQSQQRLDSLSEVSSPASPQQPRKSPVIPDSYLQRLSI
ASSASLWQDIPRVRNSTMLLSMTHENQKLQEAKFELIMSEASYLRSLHVAVDHFQLSPQL
RATLSNQEHQWLFSRLQDVRDVSTTFLSDLEENFEHNIFTFHVCDVVLTHAPAFRRVYLP
YVTNQTYQERTFQTLLSSNNNFREVLEKLESDPICQRLSLKSFLILPFQRITRLKLLLQN
ILKRTQPGSPEEAEATEAHHVLEELIRDCNNNVQRMRRTEELIYLSQKIEFECRFFPLIS
QSRWLVKSGELTALESNVLPGLRRKLATRPVHLHLFNDFLLLSRPREGNRFLVFDHSPFS
SIRGEKCEMKLHGPHKNFFRLFLRNNAHGTGAEYLFRTETQSEKLRWISALTMPREELDL
LECQDYPQVQCLRSYKPRENDELALEKADVVMVTQQSSDGWLEGVRLSDGERGWFPLSHV
EFITNSDVRKRNLSEALRVKTAKLQLVGRQR
Download sequence
Identical sequences F6TN87
ENSMODP00000002001 XP_007504567.1.35504 ENSMODP00000002001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]