SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002046 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002046
Domain Number 1 Region: 30-244
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 9.29e-50
Family DBL homology domain (DH-domain) 0.00000233
Further Details:      
 
Domain Number 2 Region: 231-393
Classification Level Classification E-value
Superfamily PH domain-like 5.84e-28
Family Pleckstrin-homology domain (PH domain) 0.0094
Further Details:      
 
Domain Number 3 Region: 503-574
Classification Level Classification E-value
Superfamily SH2 domain 0.0000000623
Family SH2 domain 0.0043
Further Details:      
 
Domain Number 4 Region: 447-494
Classification Level Classification E-value
Superfamily SH3-domain 0.00000199
Family SH3-domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002046   Gene: ENSMODG00000001674   Transcript: ENSMODT00000002089
Sequence length 615
Comment pep:novel chromosome:BROADO5:5:120576610:120578568:-1 gene:ENSMODG00000001674 transcript:ENSMODT00000002089 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DMAALKDHHHVCDCVPGEDEGEHIYENVASLIDQQPLKKGMTEDEKRNCCLLEIHLTEGK
YYETLKDIEKNCMNPLKLLLSPLERTAIFINLEELIKVQESFLRAIDASVMAGGSSLAKV
FLEFKEQLLVYVEYCSNMESAQKTLSHLLANREDLRQKVKECSLKVHHGHFTLQDLLAVP
MQRILKYHLLLKELLKHSADPEERQQLQQALEAMQDLAMHINEVKRDKEILKKISEFQSS
IENLQVKLVEFGKPKIHGELKVRCISGNHNKQDRCLFLFDKVVLVCKRKGTKYKLQEMLD
LLFHKMTDDPVNNKDPRKWSYGFSLIHLQGKQGFQIFCKTEDMKRKWMEQFERAMSNLKP
EKANANHHNFQMNTFDKTTNCEACKMFLKGTFCQGYLCTKCGVGAHKDCLEAFPSCNIRS
PEYLDTLSMRVLPKLGTVQSYHDIPSPPGKSGLTCQGGDVFELLRGPPDSQWEEGRLMQT
QESGSFPSSSVKPWSVRARLQAVGSYLEKQTIQDSLALPFKYEMKHIKVVKKANSFYVTE
SKMFESLLDLLEYYQCHSLKEDSEDLDTTLESPYKFPLHSCSKASTWSRGYNPHVIGMTL
AINNFAARDLSELPL
Download sequence
Identical sequences F6SQP5
ENSMODP00000002046 13616.ENSMODP00000002046 ENSMODP00000002046

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]