SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002126 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002126
Domain Number 1 Region: 679-786
Classification Level Classification E-value
Superfamily SH2 domain 5.25e-31
Family SH2 domain 0.00000286
Further Details:      
 
Domain Number 2 Region: 388-492
Classification Level Classification E-value
Superfamily SH2 domain 2.15e-29
Family SH2 domain 0.00000234
Further Details:      
 
Domain Number 3 Region: 184-359
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.53e-22
Family BCR-homology GTPase activation domain (BH-domain) 0.00039
Further Details:      
 
Domain Number 4 Region: 64-141
Classification Level Classification E-value
Superfamily SH3-domain 4.41e-16
Family SH3-domain 0.000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002126   Gene: ENSMODG00000001734   Transcript: ENSMODT00000002169
Sequence length 789
Comment pep:novel chromosome:BROADO5:Un:56769575:56796012:1 gene:ENSMODG00000001734 transcript:ENSMODT00000002169 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSLRQSCGPPRTRAVLPGVPPGPEHGEAGPVLHRLAQSGLQAAEKRLGRVRPPRSPRGAM
ASAEGFQYRALYQYHKEREEDLDLLPGDILVVSKGTLEALGYQDGDEQSPQHIGWILGVN
ERTKQKGDFPGTYVEYLGPVKIALPSHRPRGHRPLPATPGRPRDSPEPAGALLPDLPEQF
VPPEVAPPILQKLVEAIERKGLDSDALYRPSSEPRPPKIDWTLSDVDQWDVTALSEALKG
YLQALPRPLVPPGAHGDILHALQGESPPSQQLQVALEPPVVPLHNALTLRFLLQHLGRVA
QRARAQGSGLGPQALGEIFGPLLLRLPATGSGGPPPPRTEQSPDFSALFLEMLLQDQEEE
QEPPPPALPPKPPKPKVQAGSLSNGSSAPLQEAEWYWGDISREEVNEKLRDTPDGTFLVR
DASSKIQGEYTLTLRKGGNNKLIKVFHRDGQYGFSEPLTFSSVVELITHYRHESLAQYNA
KLDTRLLYPVSKHQQDQVVKEDSVEAVGQLKVYHQQYQDQSREYDLLYEEYTRTSQELQM
KRTAIEAFNETIKIFEEQGQTQEKCSKDYLERFRREGNEKEIQRILMNSEKLKSRIAEIH
DSKMKLEQDLRAQAADNREIDKRMNSLKPDLMQLRKIRDQYLVMDERLRGGTERRPGRAL
RLPPSLTHSQYSMVDEEEDLPHHEERTWYVGKINRGRAEEMLSGKRDGTFLIRESSQRGC
YACSVVVDGDTKHCVIYKTVTGYGFAEPYNLYASLKDLVLHYKHTSLVQHNDSLNVTLAH
PVLSPPPAR
Download sequence
Identical sequences H9H5Y1
ENSMODP00000002126 ENSMODP00000002126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]