SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002218 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002218
Domain Number 1 Region: 41-169
Classification Level Classification E-value
Superfamily N-terminal domain of cbl (N-cbl) 8.24e-57
Family N-terminal domain of cbl (N-cbl) 0.00000141
Further Details:      
 
Domain Number 2 Region: 256-342
Classification Level Classification E-value
Superfamily SH2 domain 2.8e-47
Family SH2 domain 0.00000425
Further Details:      
 
Domain Number 3 Region: 349-426
Classification Level Classification E-value
Superfamily RING/U-box 9.77e-43
Family RING finger domain, C3HC4 0.0000109
Further Details:      
 
Domain Number 4 Region: 171-255
Classification Level Classification E-value
Superfamily EF-hand 6.61e-37
Family EF-hand modules in multidomain proteins 0.000011
Further Details:      
 
Domain Number 5 Region: 927-970
Classification Level Classification E-value
Superfamily UBA-like 0.0000681
Family UBA domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002218   Gene: ENSMODG00000001816   Transcript: ENSMODT00000002263
Sequence length 983
Comment pep:known_by_projection chromosome:BROADO5:4:56213574:56434582:1 gene:ENSMODG00000001816 transcript:ENSMODT00000002263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MANAMNGRNPGGRGGNPRKGRILGIIDAIQDAVGPPKQAAADRRTVEKTWKLMDKVVRLC
QNPKLQLKNSPPYILDILPDTYQHLRLILSKYDDNQKLAQLSENEYFKIYIDSLMKKSKR
AIRLFKEGKERMYEEQSQDRRNLTKLSLIFSHMLAEIKAIFPNGQFQGDNFRITKADAAE
FWRKFFGDKTIVPWKVFRQCLHEVHQISSGLEAMALKSTIDLTCNDYISIFEFDIFTRLF
QPWGSILRNWNFLAVTHPGYMAFLTYDEVKARLQKYSTKPGSYIFRLSCTRLGQWAIGYV
TGDGNILQTIPHNKPLFQALIDGSREGFYLYPDGRSYNPDLTGLCEPTPHDHIKVTQEQY
ELYCEMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTAWQESDGQGCPFCRCEIKGTEP
IIVDPFDPRDESSRCCSIIDTFSMPMLDLDDDDDREESLMMNRLASVRKCNERQNSPVTS
PGSSPLAQRRKPLPDPLQIPHLSLPPVPPRLDLIQKGVVRSPCGSPTGSPKSSPCMVRKQ
DKPLPAPPPPLRDPPPPPPERPPPIPPDNRLSRHFHHLESVPSRDQPMPLEAWCPRDVFG
TNPLLGCRILGDGSPKPGLTASSNINGRHSRIGSDQVLLRKHRRHDLPLEGAKVFSNGHL
GSEEYDVPPRLSPPLPTTSFLSNLKCPIPLTNSLSEKIKENVEEEDDDYKIPSSHPVSLS
LQPPHCHSIKPPLRSCENGQCIMNGIHSSSSELKKSNPPELGIYIKGDVFDSAIVPVPIP
PARPPSRDNPKHDSSLNRTPSDYDLLIPPLGEDAFDVLPPSLPPPPPPARLSLIEHTKPP
GSGSRPSSGHELFLPPSDPFFDPSNGLVPMPPARRLASENVKTNRTSQDYDQLPSSSDGS
QAPARPPKPRPRKTAPEIHHRKAHGPEAALENVDAKIAKLMGEGYSFEEVKRALEIAQNN
VDVARSILREFAFPPPVSPRLNL
Download sequence
Identical sequences F6T5M5
ENSMODP00000002218 ENSMODP00000002218 XP_001363223.1.35504 XP_007493590.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]