SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002244 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002244
Domain Number 1 Region: 838-1073
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 8.11e-56
Family DBL homology domain (DH-domain) 0.0000313
Further Details:      
 
Domain Number 2 Region: 1071-1199
Classification Level Classification E-value
Superfamily PH domain-like 6.97e-34
Family Pleckstrin-homology domain (PH domain) 0.0012
Further Details:      
 
Domain Number 3 Region: 653-707
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.0000000000227
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.012
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002244
Domain Number - Region: 166-235
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00282
Family Ankyrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002244   Gene: ENSMODG00000001838   Transcript: ENSMODT00000002289
Sequence length 1710
Comment pep:known_by_projection chromosome:BROADO5:3:48096095:48443604:1 gene:ENSMODG00000001838 transcript:ENSMODT00000002289 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQQHILSLDTETMELSSYEAPLYGQMKVYAKFDQNVYLPKDAEFYFIYNGSRQRHVTFA
QRVGDNILQSSIPGHALEETVSVSTCLHSEGYSPVTMGCCSIKYMDNMACRLSRSLVSQI
GSFTCNSHQTLLDQFGLKMKELHALDGNLVLALAHLELPHGWNILGNSSGEVTEHKESLL
HITVRWGLVKFSQFLLCLPGGRQALTLTNEEGDMPLDVAVKLGHSRLAEVINNFQGSHST
DFSRVQINEHALLRFVHSSGTLTLTLNHTAEHLLEADIKLFRKYFLDRALLHKTLDRKEE
RTEKRLPIPSSATRTEGEPENLVSGKSPPEREDVKHFPDSMVQPTENEDLHFERHHSFDV
LKKSKNSSTFLAASRLSNMLNGSDEVYANCMVIDQVGDLDINYINVEGITAQSSPESMNS
TLLSQNCACALPKETRQDIIALSENSQETVNSGECQPFMSPTSSHLPFKLRELEKEQSQL
KKRSSSLDALDVDSEGEGNSEQSHICYPPETHISSATGITSGDELDSFETNVELDFNISR
TESLSISSNLQSKDSLLSGLRSRSYSCSSPKISLGKTRLIRDYTVCDSSEEQRAYSLSEP
SREKRIQEEEWDKYIIPAKSESEKYKVSRTFSFLMNRMTSPRNKSKTKNKDAKDKEKLNR
HQFVPGMFSGVLPCFVCDKLILGKESFQCAICNASVHKSCRECALPCTKKLQEKYHNKNR
PQAILGNSSFRDIPHPNSSSLHPSSMPIGLPTGRKETTCPGNSLSRSVPGTSLESFRRSV
TSLESDADSSNWRTRSHSDELLQSMGSSPSMDSFIMEEVVDSSLWSDLSSDAQEFEAESW
SLVVEPSFCSRQEKDVIKRQDVIFELMQTEMHHIQTLLIMSEIFRKGMKEELQLDHSTVD
KIFPCLDELLEVHRHFFYSMKERRQESCEDSDRNFVINRIGDILVQQFSEENATTMKKIY
GEFCSHHKEAVSLFKELQQNKKFQNFIKVRNSNLLARRRGIPECILLVTQRITKYPVLVE
RILQYSKEGTEEHKDLCKALCLIKDMIAAVDLTVNEYEKKQKWLEILNKIENKTCTKLKN
GHVFRKQALISKERTLLYDGLVYWKTATGRFKDILALLLTDVLLFLQEKDQKYIFAAVDQ
KPSVISLQKLIAREVANEERGMFLISASSAGPEMYEIHTNSKEERNNWMRRIQQAVESCP
EEEGGRTSESDEDKKKTEARVARIQQCQEILSNQDQQICTYLEEKLHIYAELGEMSGLED
VHLEPHLLIKPDPGEAPQAASLLAAALKEAESLQVAVMATQTGDANHSSEENCGELGSTD
ALQASEVPEPSTASQVTEGEGRRESCNMESCIRGIVNNMAGPDAGEKAEYIDFPGSSQAE
IIQAIQNLTRLLYSLQAALTIQDSHIELHKLILQQHEKMPHGLSFRGGLLQEQDKSRHLE
KQREELANIHKLQHQFQQEQQRWYRKCDQRQREQEAKEKWLQEREKECQSQEELLSRSRG
ELDHQLQEYQQNLERLREGQRMVEREREKVRIQQSLLCHWKHSRQSSLPAAFSPGNEVTD
LIRSDSLCHENSFFVNEALVQMSLNTLNKSNSSGVPQDILYPLNISDSDLTRTSENQTDL
KMDISYHSDVTHELWRTTDPGHQVPSLLRGSKDCCNNDLEENQSPCSKTPNLNPGSTQPW
QNPEAKLNLPSTSLHDGDSGDGVEENIVYL
Download sequence
Identical sequences F6SPS8
ENSMODP00000002244 ENSMODP00000002244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]