SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002264 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002264
Domain Number 1 Region: 489-724
Classification Level Classification E-value
Superfamily SET domain 1.01e-61
Family Histone lysine methyltransferases 0.0018
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002264
Domain Number - Region: 419-457
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00141
Family Myb/SANT domain 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002264   Gene: ENSMODG00000001852   Transcript: ENSMODT00000002309
Sequence length 734
Comment pep:novel chromosome:BROADO5:8:212989472:213048055:-1 gene:ENSMODG00000001852 transcript:ENSMODT00000002309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGQTGKKSEKGPVCWRKRVKSEYMRLRQLKRFRRADEVKSMFNSNRQKILERTEILNQEW
KQRRIQPVHIMTSVSSLRGTRECSVTSDLDFPKQVIPLKTLNAVASVPIMYSWSPLQQNF
MVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALDE
KQKDLEDNRDDDKESHPPRKFPSDKIFEAISSMFPDKGTSEELKEKYKELTEQQLPGALP
PECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHRKFNYSFHATPNTYKRKNTE
TALDNKPCGPHCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLPNNSSRPSTPTINV
LESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKMKPNIEPPENVEW
SGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPVPAEDVDTPPRKK
KRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQNFCEKFCQCSSE
CQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVSCKNCSIQRGSKK
HLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDKYMCSFLFNLNND
FVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGEELFFDYRYSQAD
ALKYVGIEREMEIP
Download sequence
Identical sequences F6SP16
ENSMODP00000002264 ENSMODP00000002264 13616.ENSMODP00000002264

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]