SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002281 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002281
Domain Number 1 Region: 14-143
Classification Level Classification E-value
Superfamily Inhibitor of apoptosis (IAP) repeat 2.09e-37
Family Inhibitor of apoptosis (IAP) repeat 0.000000694
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002281   Gene: ENSMODG00000001871   Transcript: ENSMODT00000002328
Sequence length 150
Comment pep:known_by_projection chromosome:BROADO5:2:239617149:239640926:-1 gene:ENSMODG00000001871 transcript:ENSMODT00000002328 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVCVSGTKMSVPPLPPMWQLYLLDTRISTFQNWPFTEDCACTPERMAEAGFIHCPSENEP
DLAQCFFCFKELEGWEPEDDPMLEHKKHSSSCAFISIKKKIEDLTLNEFLKLDKERAKNK
IEKETSRKRTEFEEHAKEVRHDIEQLAALE
Download sequence
Identical sequences F6S6F8
ENSMODP00000002281 ENSMODP00000002281 XP_001380429.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]