SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002295 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002295
Domain Number 1 Region: 32-129
Classification Level Classification E-value
Superfamily SH2 domain 3.64e-23
Family SH2 domain 0.00027
Further Details:      
 
Domain Number 2 Region: 176-223
Classification Level Classification E-value
Superfamily SOCS box-like 0.000000000249
Family SOCS box-like 0.0029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002295   Gene: ENSMODG00000001881   Transcript: ENSMODT00000002343
Sequence length 225
Comment pep:known_by_projection chromosome:BROADO5:2:239288461:239289165:1 gene:ENSMODG00000001881 transcript:ENSMODT00000002343 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVTHSKFPATGMNRPLDTSLRLKTFSSKSEYQLVVNAVRKLQESGFYWSAVTGGEANLLL
SAEPAGTFLIRDSSDQRHFFTLSVKTQSGTKNLRIQCEGGSFSLQSDPRSTQPVPRFDCV
LKLVHHYMPPSSSSSSSSSSSSSSSSLQDQMLPQPLPGAPPKRTYYIYSGGEKIPLVLSR
PLSSNVASLQHLCRKTVNGHLDSYEKVTQLPGPIREFLDQYDAPL
Download sequence
Identical sequences F6S5F8
ENSMODP00000002295 13616.ENSMODP00000002295 ENSMODP00000002295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]