SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002358 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002358
Domain Number 1 Region: 143-693,869-1062
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.67e-254
Family Motor proteins 0.00000000299
Further Details:      
 
Domain Number 2 Region: 2119-2252
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-38
Family BCR-homology GTPase activation domain (BH-domain) 0.00031
Further Details:      
 
Domain Number 3 Region: 17-112
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000000000011
Family Ras-binding domain, RBD 0.011
Further Details:      
 
Domain Number 4 Region: 2053-2112
Classification Level Classification E-value
Superfamily Cysteine-rich domain 0.000000000000344
Family Protein kinase cysteine-rich domain (cys2, phorbol-binding domain) 0.0061
Further Details:      
 
Domain Number 5 Region: 1075-1164
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000354
Family Tandem AAA-ATPase domain 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002358   Gene: ENSMODG00000001934   Transcript: ENSMODT00000002408
Sequence length 2253
Comment pep:known_by_projection chromosome:BROADO5:1:66002545:66194866:1 gene:ENSMODG00000001934 transcript:ENSMODT00000002408 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNVSDVGGRRRFEDNEHTLHIYPGTIAEGTIYCAVPARKNSTAAEVIDALINRLQLDKTK
CYVLAEVKEFGGEEWILNPTDCPVQRMMMWPRMALENKLSGEDYRFLLREKNLDGSIHYG
SLQSWLRVTEERRRMMERGFLPQPQQKDYDDLCSLPDLNEKTLLENLRNRFKQEKIYTYV
GSILIVINPFKFLPIYNPKYVKMYDNHQLGKLEPHIYAVADVAYHAMLQRRKNQCIVISG
ESGSGKTQSTNFLIHHLTALSQKGFASGVEQIILGAGPVLEAFGNAKTAHNNNSSRFGKF
IQVNYQETGTVRGAYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEEERAAFHLKQPE
EYHYLNQMTKKPLRQSWDDYYYDSEPDCSIVDGEDLKHDFERLQLAMEMVGFLPKTRRQI
FSLLSAILHLGNICYKKKTYRDESIDICNPEVLPIVSELLEVKEEMLFEALVTRKTVTVG
EKLILPYKQAEAITVRNSMAKSLYSALFDWIVFRINHALLNTKDLEESTKTLSIGVLDIF
GFEDYESNSFEQFCINFANERLQHYFNQHIFKLEQEEYRTEGISWHNIDYIDNSGCINLI
SKKPTGLLHLLDEESNFPQATNQTLLDKFKRQHEGNSYIEFPAVMEPAFIIKHYAGKVKY
GVKDFREKNTDHMRPDIVALLRSSKNAFICGMIGIDPVAVFRWAILRAFFRALIAFREAG
KRYIQKKIGKDDAGPCAVLKSVDSFSFLHHPVHQRSLEILQRCKEEKYSITRKNPRTPLS
DLQGVNTLNEKSQRDTFGIDWNGRTSIRPSKLSSCSSLLDKDGIFINSTNSKLLERAHGI
LMRNKNFKPKPALPKHLLEVNSLKHLTNLTLQDRITKSLLHLHKKKKPPSISAQFQVSLN
KLMETLGQAEPYFVKCIRSNAEKLPLRFSDPLVLRQLRYTGMLETVRIRQSGYSCKYSFQ
DFVDHFHVLLQRDTIPSKFNIQDFFRKIKLSPKNYQVGKTMVFLKEQERQHLQDLLHQEV
LQRIILLQRWFRAMLSRQHFLHLRQAVVILQRSWRNYLSRKHAEGKDVQTDALVVNNAAA
VLQAAWRAYWGRRQYLQMRTAASIIQETWREHCRRRHAAATCIQAGWRGYWKSKLYKEQR
NKIILLQAACRGFRARQRFRALKEQRLKETKLKNGLAIKENTLEIRGSDPSKWEDGSFEE
RMKAVEEYRFVVENNRIGHANSVDISEDLPCKQQERAISQSSVDLEQDVIVRQRRKSLED
LNQKKVGRAKRESRRMRELEQAIFSLKLLKVRGGISPSEERRWSTELISEGLRSSQGSPE
SESSQESLELLSFEENPKNKPDSVFSNEEDIHIPSPKVQKGLPHDPSFDLQENTPIVADE
NSNIFIRKRTPSNSEFSESVARKDRKDCDSQTITYKPQFRETFISNSLPTFYIPPQNPTK
VSPEFGTGTLKNLASGSEEKSGTAVTLDIDKESRKHHCLEEDRTAASMNVDSSNTVLKKL
ERLNMEKEERQKQLQQQNEKEMMEQIRQQKDILERERKAIKNIEIPWKTESSLTKPVRPS
KQTVERPQSLLINPTNREEQNLPGPLTVTIKGLTVSPKGGTPDESVQRDRPVTMFFEGKE
SQRQLGIPQVRTEGWNTKLNVASKELHSHEGRTKAIFFTPKDHLGLSYFSKEYLSHGNNQ
LHTRGEPPGKPVKFTGPGRGEVARPAHKKKARMARTRSDFLTRGTFADGEGDTEEDDYDD
IIEPLLPPHQASHPEPGPSASLGQAYHSDSEMTLQRFASSESQTKLHKTMSQGEITNLAS
VQKTSVADGRPQKAKMRFWAKGKQGDKKASRERLAPQAELLEFSADPEPGGIDMFPVLHH
PEEIGPHDPTPPRSPDLSGNCKKEFKENKDPSPKAKRKRSVKISNVALESVQWQNDSVQI
ITRASDLKSMDEFLLKKMNDLDNEDSKKDTLVDVVFKKALKEFRQNIFSFYSSALAMDDG
KSIRYKDLYALFEQILEKTMRLEQRDWSESPVKVWVNTFKVFLDEYMTEFKLLDCIATKV
PKTERKKRRKKEADFVEEHNGHIFKATQYSIPTYCEYCSSLIWIMDRASVCKLCKYACHK
KCCLKTTAKCSKKYDPELSSRQFGVELSRLTSEERTVPLVVEKLINYIEMHGLYTEGIYR
KSGSTNKIKELRQGLDTDLDSVNLDDYNIHVIASVFKQWLRDLPNPLMTFELYEEFLRAM
GLQERKETIHGVYSVIDQLSRTHLNTLERLIFI
Download sequence
Identical sequences F6W0M8
ENSMODP00000002358 ENSMODP00000002358

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]