SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002409 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002409
Domain Number 1 Region: 2-41
Classification Level Classification E-value
Superfamily RING/U-box 0.0000000000377
Family RING finger domain, C3HC4 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002409   Gene: ENSMODG00000001977   Transcript: ENSMODT00000002459
Sequence length 441
Comment pep:novel chromosome:BROADO5:5:116544740:116546221:-1 gene:ENSMODG00000001977 transcript:ENSMODT00000002459 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TEILVEPVSLPCGHTLCHSCFQQTVQKASLYCPFCRRRVSSWARAQARQNTLINLELWRR
IEKQYLRGGGQAGGAGRIGGGELEMELPPRRLSAPGELRREYEEELSKVEAEKRACAEEE
ARVSAEYISQLLAAEEEEERRREEEEKETGRQTLEGQLKIDKELAQEISISLKTLKCVLT
SLFASPTPGRSPKKTEIKLNSSRDIQKYMTPKSPLASPTLQTELGLAEGKRCSKSKEVNS
SKGKNSKRQEERGDLPILCKHAFCKIENIGARASLENGVETCFKGENKPGTSREDKIIRH
YNIAHHKLPKTKFFCSGKAVAKSSGKSENESTAEMKKEGTSLLLDKEILRKKSLESPSES
LSDSDFSTKKRKIFPETTSDKEEGKSSFTQKLIDLEHLFFERHKQEEEDRVLAFQLQGEM
NKEQEKLDRGKGTPNEYLLRS
Download sequence
Identical sequences F6RIL6
ENSMODP00000002409 13616.ENSMODP00000002409 ENSMODP00000002409

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]