SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002441 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002441
Domain Number 1 Region: 308-483
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.12e-17
Family Canonical RBD 0.0081
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002441
Domain Number - Region: 502-540
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0518
Family FYVE, a phosphatidylinositol-3-phosphate binding domain 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002441   Gene: ENSMODG00000002000   Transcript: ENSMODT00000002492
Sequence length 560
Comment pep:novel chromosome:BROADO5:1:66375980:66455769:1 gene:ENSMODG00000002000 transcript:ENSMODT00000002492 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFSLKEDTGRIKDCWDSPEAPALSTCSNADIFRRINAMLDNSLDFSRVCTTPITKGRHD
HLSDFPDSEGTVTSRMLFPTSAQESSRGLPDANDLCLGLQSLSLTGWDRPWSTQDSDAAA
QSSPQSVLSMLNNPLGNVLGKPPLGFLPLDPTNTELVEKFPTPSMRGSRLDARPVLDSRS
SSPSDSDTSGFSSGSDHLSDLISSLRISPPLPFLPLGAGPRDPLKMGVGSWLDQDQAALA
AVTPSPTNASKRWPGASVWPSWDLLEAPEDPFSIEREARLHRQAAAVNEATCTWSGQLPP
RNYKNPIYSCKVFLGGVPWDITEAGLINTFRVFGSLSVEWPGKDGKHPRCPPKGYVYLVF
ELEKSVRALLQACSQDPLSPDGLSEYYFKMSSRRMRCKEVQVIPWVLADSNFVRSPSQRL
DPSRTVFVGALHGMLNAEALAAIVNDLFGGVVYAGIDTDKHKYPIGSGRVTFNNQRSYLK
AVSAAFVEIKTTKFTKKVQIDPYLEDSLCHICSAQPGPFFCRDQVCFKYFCRSCWHWRHS
TEGLRHHRPLMRNQKSRESS
Download sequence
Identical sequences F6RHI7
ENSMODP00000002441 XP_007478624.1.35504 ENSMODP00000002441

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]