SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002547 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002547
Domain Number 1 Region: 137-221
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.05e-25
Family Canonical RBD 0.0000163
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002547   Gene: ENSMODG00000002089   Transcript: ENSMODT00000002599
Sequence length 357
Comment pep:known_by_projection chromosome:BROADO5:2:237936051:238133918:1 gene:ENSMODG00000002089 transcript:ENSMODT00000002599 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLCSMANSGCLLLSNSGSMLPHSVPCPPAFLYLQQGNQDTTAPPEAMAQPYPQAQYPPPP
QNSIPTEYVPPHPHPTQDYSGQTTVPEHAMTLYTPAQTHPEQPGTDASTQPITGTQTVPQ
TDEAAQTDSQQLHSSENTDKQQPKRLHVSNIPFRFRDPDLRQMFGQFGKILDVEIIFNER
GSKGFGFVTFETSTDADRAREKLNGTIVEGRKIEVNNATARVMTNKKTTNPYTNGWKLNP
VVGAVYGPEFYAVTGFPYPTTGTAVAYRGAHLRGRGRAVYNTFRAAPPPPPIPTYGAVVY
QDGFYGAEIYGGYAAYRYAQPAAAAAAYSDSYGRVYAAADPYHHAIGPAATYSIGTM
Download sequence
Identical sequences F6UZ32
ENSMODP00000002547 ENSMODP00000002547

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]