SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002593 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002593
Domain Number 1 Region: 99-188
Classification Level Classification E-value
Superfamily NSFL1 (p97 ATPase) cofactor p47, SEP domain 3.27e-26
Family NSFL1 (p97 ATPase) cofactor p47, SEP domain 0.0002
Further Details:      
 
Domain Number 2 Region: 172-286
Classification Level Classification E-value
Superfamily Ubiquitin-like 2.45e-25
Family UBX domain 0.00043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002593   Gene: ENSMODG00000002133   Transcript: ENSMODT00000002647
Sequence length 295
Comment pep:known_by_projection chromosome:BROADO5:Un:30651082:30655345:1 gene:ENSMODG00000002133 transcript:ENSMODT00000002647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFGPVDCVPNDRTRKENAGDCFLWSCSFSFHFAAGAGRMKEVEKLESLREDWLCESGAE
GQSHRGSQAGSCELFFDSLLEEAQRGGSEHLPSAAAVTQADVSIKLWQNGFTVNGEFRSY
GDGASQQFLNAIRKGELPSELRGRFSQEEVAVRVEDKKEQVFVPRKPAFAPFSGRGHRLG
SATPRIVSKASGEAGPPKPLAAPAVPLNPWEPVTSIQIWLADGRRLVQRFNVSHRVSHVR
DFIRSCEGSPRSAPFSLVTALPGLRPLDDALTLEEAGLRNAVVIQRRPAPRAPAV
Download sequence
Identical sequences H9H5Z5
ENSMODP00000002593 ENSMODP00000002593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]