SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002600 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002600
Domain Number 1 Region: 360-466
Classification Level Classification E-value
Superfamily SH2 domain 4.04e-31
Family SH2 domain 0.00000317
Further Details:      
 
Domain Number 2 Region: 74-169
Classification Level Classification E-value
Superfamily SH2 domain 4.31e-27
Family SH2 domain 0.00000294
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002600   Gene: ENSMODG00000002139   Transcript: ENSMODT00000002654
Sequence length 472
Comment pep:novel chromosome:BROADO5:2:8637999:8679577:1 gene:ENSMODG00000002139 transcript:ENSMODT00000002654 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MYTPPWGMEREDGGEGEGEGGEGGESEDWRDVTMPYSTELIFYIEMDPPALPPKPPKSLT
QAGANGAKDSSGFSLPDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKVQGDYTLTLR
KGGNNKLIKIYHRDGKYGFSDPLTFSSVVELINHYRHESLAQYNPKLDTGLGGSSASPSC
ARQDQLVKEDNIDAVGTKLQEYHSQYQDKSREYDRLYEEYTRTSQEIQMKRTAIEAFNET
IKIFEEQCQTQERQSKDYIERFRREGNEKEIERLQGWRLHEAPPGTIETLPALGIDQWEG
EGGASAQQPTGHLGSLLQGPKVGRCGVGLALLGPSRVQHTPGLLAPDTAPTYFMKEEEEN
RPHKDEKTWFVGDLNRLQAEDLLHGKPDGAFLIRESSKKGCYACSVVADGDVKHCVIYST
ARGYGFAEPYNLYGTLKELVLHYQHTSLVQHNDSLNVRLAHPVYAQLPSHCR
Download sequence
Identical sequences F6YF70
ENSMODP00000002600 ENSMODP00000002600 13616.ENSMODP00000002600

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]