SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002604 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002604
Domain Number 1 Region: 18-88
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 1.48e-21
Family Canonical RBD 0.0000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002604   Gene: ENSMODG00000002144   Transcript: ENSMODT00000002658
Sequence length 125
Comment pep:known_by_projection chromosome:BROADO5:Un:30685718:30687409:-1 gene:ENSMODG00000002144 transcript:ENSMODT00000002658 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAMQAAKRANIRLPPEVNRILYIRNLPYKITAEEMYDIFGKYGPIRQIRVGNTPETRGTA
YVVYEDIFDAKNACDHLSGFNVCNRYPRGALLQRHRAFQKMDTKKKEEQLKLLKEKYGIN
TDPPK
Download sequence
Identical sequences H9H5Z7
13616.ENSMODP00000002604 ENSMODP00000002604 ENSMODP00000002604 XP_001364306.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]