SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002674 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002674
Domain Number 1 Region: 28-108
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.00000381
Family Canonical RBD 0.0001
Further Details:      
 
Domain Number 2 Region: 197-270
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.0000835
Family Canonical RBD 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002674   Gene: ENSMODG00000002200   Transcript: ENSMODT00000002729
Sequence length 326
Comment pep:novel chromosome:BROADO5:2:113693480:113695116:-1 gene:ENSMODG00000002200 transcript:ENSMODT00000002729 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGYRYVEVFKSNNIKMNWMLKYTGPNSSNAANNGFVNLRGFSLGFGKEEIVYFFSGLEVV
PNEITLLVDFQGRTGEDCIQFSSQEIARKALKRPKERIEHKYPEICKSGLAEVSACYNPP
QKLMTMQWPGPCDSFGAGRGYNSLSRETGFERMRVPRGFGDYDDYNNYNDGYDFRPYRFG
RDLKHCFSRKSEHRYRDGGSTFQGTTGYFVHMKEFPYRATENAIYNLFSYHSTLLEVIGE
GDAEFATYLVAVAMSKDKTNVQHKYVGLFLNATAGASGGAHGSHMMGGMGSLSQSTYGGP
ASQQLSGDYGRGYNVQSSMSGYDQVL
Download sequence
Identical sequences F7GDX6
13616.ENSMODP00000002674 ENSMODP00000002674 ENSMODP00000002674

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]